DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31064 and Rundc3a

DIOPT Version :9

Sequence 1:NP_001287560.1 Gene:CG31064 / 43277 FlyBaseID:FBgn0051064 Length:877 Species:Drosophila melanogaster
Sequence 2:NP_942053.2 Gene:Rundc3a / 303569 RGDID:735057 Length:454 Species:Rattus norvegicus


Alignment Length:394 Identity:102/394 - (25%)
Similarity:163/394 - (41%) Gaps:105/394 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   280 IERSNLVNICKLVVKELLEQSLRY-GRMLDSDHLPLQHFFIVIEHVLGHGLR---PKKGLLGP-- 338
            :||.||:.:|:..||.|||   :| ...:|.......:|..::|.:|.|..:   |    .||  
  Rat    26 VERRNLITVCRFSVKTLLE---KYTAEPIDDSSEEFVNFAAILEQILSHRFKACAP----AGPVS 83

  Fly   339 ------RKELWDLLQ----SVEHYCPEAQDITASVRDLPTVRTHIGRARAWLRIALMQKKLSDYL 393
                  ::..||.::    .|.:.|      .:|:.::..:.|...:.|||:|:|||:|::|:|:
  Rat    84 WFSSDGQRGFWDYIRLACSKVPNNC------VSSIENMENISTARAKGRAWIRVALMEKRMSEYI 142

  Fly   394 -QALIEHREDSLFDYYEPHALMMSDEIVVIMGILVGLNVIDCNLCVKEEDLDSQQG-VIDFSLYL 456
             .||.::|....|  |:..|:|:.:|..|:.|:|:||:.||.:.|:|.|.||.:.. |||::.||
  Rat   143 TTALRDNRTTRRF--YDSGAIMLREEATVLTGMLIGLSAIDFSFCLKGEVLDGKTPVVIDYTPYL 205

  Fly   457 R-----------------SSSRNADAAPEDSAPPALLDATGQGN--------MIAVLDQKNYIEE 496
            :                 .||.:.|.:||....|.:.|.....|        ...|..||.|:||
  Rat   206 KFTQSYDYLTDEEERHSAESSTSEDNSPEHPYLPLVTDEDSWYNKWHKMEQKFRIVYAQKGYLEE 270

  Fly   497 LNR-------HLNATVGNLQAKVESLTTTNALMKEDLAIARNSLLALQAE----NQAMRQSTSAG 550
            |.|       .|.|....||.::|.....|...|.:|   ...:|.||.:    ....|.....|
  Rat   271 LVRLRESQLKDLEAENRRLQLQLEEAAAQNQREKREL---EGVILELQEQLPDPPPPPRTGLIPG 332

  Fly   551 DNNSTGSGGSSDKDKEKASEELV---------------EERRKNSEL--------EKELKLQVSL 592
            |:.....|          |:||.               .|...||:|        .:.|..:.||
  Rat   333 DHAPLAQG----------SKELTTALVNQWPSLSTLSRPEGASNSKLFRRHSFMSTEPLSAEASL 387

  Fly   593 KAES 596
            .::|
  Rat   388 SSDS 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31064NP_001287560.1 RUN 316..439 CDD:280855 39/138 (28%)
CASP_C 495..>634 CDD:285395 30/136 (22%)
FYVE_RUFY1_like 813..874 CDD:277261
Rundc3aNP_942053.2 RUN 60..186 CDD:397055 38/137 (28%)
UPF0242 <238..>318 CDD:399636 22/82 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343801
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4381
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.