DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31064 and Zfyve1

DIOPT Version :9

Sequence 1:NP_001287560.1 Gene:CG31064 / 43277 FlyBaseID:FBgn0051064 Length:877 Species:Drosophila melanogaster
Sequence 2:NP_001346095.1 Gene:Zfyve1 / 217695 MGIID:3026685 Length:777 Species:Mus musculus


Alignment Length:110 Identity:41/110 - (37%)
Similarity:55/110 - (50%) Gaps:15/110 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   782 MQDQERRQRQLLSG---SAQSLQAM----PEAVGS-------PGIWAPDSIATHCTACEREFNLT 832
            ::|.....::||.|   .|||:..:    .:||.|       |..|.|:|....|..|...|...
Mouse   550 LKDNNNAAQRLLDGMNFMAQSVSELSLGPTKAVTSWLTDQIAPAYWRPNSQILSCNQCATSFKDN 614

  Fly   833 RRKHHCRSCGEIFCKACSEHTLPLLNAQGQPGKPVRVCDNCYAAK 877
            ..|||||:|||.||.:||..|.| :..:|....||||||:||.|:
Mouse   615 DTKHHCRACGEGFCDSCSSKTRP-VPERGWGPAPVRVCDSCYDAR 658

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31064NP_001287560.1 RUN 316..439 CDD:280855
CASP_C 495..>634 CDD:285395
FYVE_RUFY1_like 813..874 CDD:277261 27/60 (45%)
Zfyve1NP_001346095.1 Bbox1_ZFYVE1_rpt1 16..63 CDD:380877
Bbox1_ZFYVE1_rpt2 69..121 CDD:380878
GBP 174..410 CDD:206650
Required for localization in the lipid droplets. /evidence=ECO:0000250|UniProtKB:Q9HBF4 416..777 41/110 (37%)
FYVE_like_SF 594..655 CDD:333710 27/61 (44%)
FYVE_ZFYV1 711..771 CDD:277273
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839953
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.