DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31064 and PIKFYVE

DIOPT Version :9

Sequence 1:NP_001287560.1 Gene:CG31064 / 43277 FlyBaseID:FBgn0051064 Length:877 Species:Drosophila melanogaster
Sequence 2:XP_011509080.1 Gene:PIKFYVE / 200576 HGNCID:23785 Length:2110 Species:Homo sapiens


Alignment Length:150 Identity:40/150 - (26%)
Similarity:61/150 - (40%) Gaps:29/150 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   735 KELSEEKERNGKLKADLDKVRTQWS-----EAQTTLEELGIQLSVSKLKVSEMQDQERRQRQLLS 794
            |:|:||.:|.....||......|.:     :|:.|......:.:|....:|.:.   :|.::::.
Human    94 KQLNEELQRRSSALADNSLQHPQENTDTRRKAEPTFGGHDPRTAVQLRSLSTVL---KRLKEIME 155

  Fly   795 GSAQSLQAMPEAVGSPGIWAPDSIATHCTACEREFNLTRRKHHCRSCGEIFCKACSEHTLPLLNA 859
            |.:|......       .|.|||....|..|..:|...||:||||.||:|||..|....:     
Human   156 GKSQDSDLKQ-------YWMPDSQCKECYDCSEKFTTFRRRHHCRLCGQIFCSRCCNQEI----- 208

  Fly   860 QGQPGK------PVRVCDNC 873
               |||      .:|.|..|
Human   209 ---PGKFMGYTGDLRACTYC 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31064NP_001287560.1 RUN 316..439 CDD:280855
CASP_C 495..>634 CDD:285395
FYVE_RUFY1_like 813..874 CDD:277261 24/66 (36%)
PIKFYVEXP_011509080.1 FYVE_PIKfyve_Fab1 166..227 CDD:277264 24/67 (36%)
DEP_PIKfyve 369..450 CDD:239895
Fab1_TCP 629..889 CDD:239450
PIPKc 1784..2097 CDD:238081
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2108
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.