DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31064 and B0416.4

DIOPT Version :9

Sequence 1:NP_001287560.1 Gene:CG31064 / 43277 FlyBaseID:FBgn0051064 Length:877 Species:Drosophila melanogaster
Sequence 2:NP_509564.1 Gene:B0416.4 / 181985 WormBaseID:WBGene00015180 Length:218 Species:Caenorhabditis elegans


Alignment Length:208 Identity:45/208 - (21%)
Similarity:79/208 - (37%) Gaps:26/208 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   567 KASEELVEERRKNSELEKELK-LQVSLKAESDM---AMKLLEKDIHEKQDTIVSLRRQLDDIKQI 627
            :.|..|.|........::.|| |:..:|||.:.   .||.||.:|..|:..|...:|     |.:
 Worm     5 RRSSRLAERYDAIESKKRSLKRLEEQIKAEEEQFSDKMKQLEDEIKIKEQVITMFKR-----KTV 64

  Fly   628 NLEMYRKLQDC--KASLTHKTELMTKLEVQKEDMASTIDQLEKKWSHDKSNLGEILKTTSQTLTT 690
            ..|..|..:..  ..::.....|..:||..::|:|....|.|......::.|.|..|...:....
 Worm    65 RREWMRNSRQATTNINIAQIESLKLQLEEGEKDIAEAEKQAEPTTPQQEAELSETFKQMVRDRMK 129

  Fly   691 QVTASEERAARAEAESRIEREWR------ISLQEKELKLKEKIAN-----LQGCLKELSEEKERN 744
            .....|:...:...:..:|.|||      :.....:..|...|.|     .:.|:.:|:    .|
 Worm   130 VKDVDEKLLQQYMKKENVEFEWRSCFICTMEYSRTDKNLHPIILNCGHNLCRSCINKLT----GN 190

  Fly   745 GKLKADLDKVRTQ 757
            |.:|...|::.|:
 Worm   191 GIVKCPFDRLDTR 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31064NP_001287560.1 RUN 316..439 CDD:280855
CASP_C 495..>634 CDD:285395 19/70 (27%)
FYVE_RUFY1_like 813..874 CDD:277261
B0416.4NP_509564.1 RING 154..197 CDD:214546 8/46 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4437
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.