DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31064 and RUNDC3A

DIOPT Version :9

Sequence 1:NP_001287560.1 Gene:CG31064 / 43277 FlyBaseID:FBgn0051064 Length:877 Species:Drosophila melanogaster
Sequence 2:XP_016879524.1 Gene:RUNDC3A / 10900 HGNCID:16984 Length:474 Species:Homo sapiens


Alignment Length:415 Identity:105/415 - (25%)
Similarity:171/415 - (41%) Gaps:113/415 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 GLSTGSGSGGNAGGGGGLDITDNARDTAEIERSNLVNICKLVVKELLEQSLRY-GRMLDSDHLPL 314
            |||:...|..|..                :||.||:.:|:..||.|||   :| ...:|......
Human    13 GLSSKKASSRNVA----------------VERKNLITVCRFSVKTLLE---KYTAEPIDDSSEEF 58

  Fly   315 QHFFIVIEHVLGHGLR---PKKGLLGP--------RKELWDLLQ----SVEHYCPEAQDITASVR 364
            .:|..::|.:|.|..:   |    .||        ::..||.::    .|.:.|      .:|:.
Human    59 VNFAAILEQILSHRFKACAP----AGPVSWFSSDGQRGFWDYIRLACSKVPNNC------VSSIE 113

  Fly   365 DLPTVRTHIGRARAWLRIALMQKKLSDYL-QALIEHREDSLFDYYEPHALMMSDEIVVIMGILVG 428
            ::..:.|...:.|||:|:|||:|::|:|: .||.:.|....|  |:..|:|:.||..::.|:|:|
Human   114 NMENISTARAKGRAWIRVALMEKRMSEYITTALRDTRTTRRF--YDSGAIMLRDEATILTGMLIG 176

  Fly   429 LNVIDCNLCVKEEDLDSQQG-VIDFSLYLR-----------------SSSRNADAAPEDSAPPAL 475
            |:.||.:.|:|.|.||.:.. |||::.||:                 .||.:.|.:||....|.:
Human   177 LSAIDFSFCLKGEVLDGKTPVVIDYTPYLKFTQSYDYLTDEEERHSAESSTSEDNSPEHPYLPLV 241

  Fly   476 LDATG--------QGNMIAVLDQKNYIEELNR-------HLNATVGNLQAKVESLTTTNALMKED 525
            .|...        :.....|..||.|:|||.|       .|.|....||.::|.....|...|.:
Human   242 TDEDSWYSKWHKMEQKFRIVYAQKGYLEELVRLRESQLKDLEAENRRLQLQLEEAAAQNQREKRE 306

  Fly   526 LAIARNSLLALQAENQAMRQSTSA----GDNNST--------------GSGGSSDKDKEKASEEL 572
            |   ...:|.||.:...:..|..|    |....|              |:.|:|:.         
Human   307 L---EGVILELQEQLTGLIPSDHAPLAQGSKELTTPLVNQWPSLGTLNGAEGASNS--------- 359

  Fly   573 VEERRKNSELEKE-LKLQVSLKAES 596
             :..|::|.:..| |..:.||.::|
Human   360 -KLYRRHSFMSTEPLSAEASLSSDS 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31064NP_001287560.1 RUN 316..439 CDD:280855 39/138 (28%)
CASP_C 495..>634 CDD:285395 29/128 (23%)
FYVE_RUFY1_like 813..874 CDD:277261
RUNDC3AXP_016879524.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149907
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4381
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.