DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42813 and YSA1

DIOPT Version :9

Sequence 1:NP_001303547.1 Gene:CG42813 / 43276 FlyBaseID:FBgn0261995 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_009669.1 Gene:YSA1 / 852408 SGDID:S000000315 Length:231 Species:Saccharomyces cerevisiae


Alignment Length:198 Identity:46/198 - (23%)
Similarity:72/198 - (36%) Gaps:50/198 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LYYVQNGVEKNWD--LLKVHDS--------VAIILYNTSR-QKLVLVRQFRPAVYHGIISSAKGT 77
            :|...||.|:.||  :.....|        :.|:.|...: .:::|.:|||              
Yeast    53 IYKDPNGKEREWDSAVRTTRSSGGVDGIGILTILKYKDGKPDEILLQKQFR-------------- 103

  Fly    78 FDEVDLKEFPPAIGVTLELCAGIVDKNKSWVEIAREEVVEECGYDVPVERIEEVMVYRSGVGSSG 142
                     ||..||.:|:.||::|..:.....|..|:.||.||...:  |.:.....:..|.:.
Yeast   104 ---------PPVEGVCIEMPAGLIDAGEDIDTAALRELKEETGYSGKI--ISKSPTVFNDPGFTN 157

  Fly   143 AKQTMYYCEVTDADKATGGGGV----DDEIIEVVELSL----EEAKRMIQQG-----AVNNSPPS 194
            ....:...|| |.........|    |:|.||...:.|    :|..::.|||     .|.|....
Yeast   158 TNLCLVTVEV-DMSLPENQKPVTQLEDNEFIECFSVELHKFPDEMVKLDQQGYKLDARVQNVAQG 221

  Fly   195 CLM 197
            .||
Yeast   222 ILM 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42813NP_001303547.1 ADPRase_NUDT5 41..205 CDD:239516 40/179 (22%)
YSA1NP_009669.1 ADPRase_NUDT5 76..213 CDD:239516 35/162 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344063
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.