powered by:
Protein Alignment CG42813 and nudt8
DIOPT Version :9
Sequence 1: | NP_001303547.1 |
Gene: | CG42813 / 43276 |
FlyBaseID: | FBgn0261995 |
Length: | 212 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_021337150.1 |
Gene: | nudt8 / 791929 |
ZFINID: | ZDB-GENE-061013-219 |
Length: | 298 |
Species: | Danio rerio |
Alignment Length: | 66 |
Identity: | 15/66 - (22%) |
Similarity: | 24/66 - (36%) |
Gaps: | 22/66 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 67 YHGIISSAKGTFDEVDLKEFPPAIGVTLELCAGIVDKNKSWVEIAREEVVEECGYDVPVERIEEV 131
:.|.:|.|.|..|..| ::.|:.|..|..||.|..:|.|::..|
Zfish 208 HKGDVSFAGGKKDPSD----------------------RTVVDTALREAAEELGIHIPEEKVWGV 250
Fly 132 M 132
:
Zfish 251 L 251
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0494 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.