DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42813 and Nudt14

DIOPT Version :9

Sequence 1:NP_001303547.1 Gene:CG42813 / 43276 FlyBaseID:FBgn0261995 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_079675.1 Gene:Nudt14 / 66174 MGIID:1913424 Length:222 Species:Mus musculus


Alignment Length:222 Identity:94/222 - (42%)
Similarity:135/222 - (60%) Gaps:19/222 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MENVSKIWLGPLPQDSPYVKPFRLYYVQNGVEKNWDLLKVHDSVAIILYNTSRQKLVLVRQFRPA 65
            ||.:..:.:| |...|||::||.|:|.|:||:|:||.:|.||||.|:::|:||:.||||:|||||
Mouse     1 MERIDGVAVG-LCAHSPYLRPFTLHYRQDGVQKSWDFMKTHDSVTILMFNSSRRSLVLVKQFRPA 64

  Fly    66 VYHGIIS-------SAKGTFDEVDLKE-FPPAIGVTLELCAGIVDK-NKSWVEIAREEVVEECGY 121
            ||.|.:.       :|.......:|:: .|.:.||.:||||||||: ..|..|.|.:|..|||||
Mouse    65 VYAGEVERHFPGSLTAVNQDQPQELQQALPGSAGVMVELCAGIVDQPGLSLEEAACKEAWEECGY 129

  Fly   122 DVPVERIEEVMVYRSGVGSSGAKQTMYYCEVTDADKATGGGGV--DDEIIEVVELSLEEAKRMIQ 184
            .:....:..|..|.||||.:.::|||:|.|||||.:...|||:  :.|:|||:.|:|::|    |
Mouse   130 RLVPTDLRRVATYMSGVGLTSSRQTMFYAEVTDAQRGGPGGGLAEEGELIEVIHLNLDDA----Q 190

  Fly   185 QGAVNNSPPSCL---MGLMWFFANRAP 208
            ..|.|...|..|   ..:.|||:...|
Mouse   191 AFADNPDIPKTLGVIYAISWFFSQVVP 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42813NP_001303547.1 ADPRase_NUDT5 41..205 CDD:239516 75/177 (42%)
Nudt14NP_079675.1 TIGR00052 17..210 CDD:129162 84/196 (43%)
Nudix box 111..129 7/17 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837976
Domainoid 1 1.000 116 1.000 Domainoid score I5933
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11930
Inparanoid 1 1.050 157 1.000 Inparanoid score I4260
Isobase 1 0.950 - 0 Normalized mean entropy S5871
OMA 1 1.010 - - QHG59770
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006309
OrthoInspector 1 1.000 - - otm42486
orthoMCL 1 0.900 - - OOG6_106416
Panther 1 1.100 - - LDO PTHR11839
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4212
SonicParanoid 1 1.000 - - X6035
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.740

Return to query results.
Submit another query.