DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42813 and Nudt8

DIOPT Version :9

Sequence 1:NP_001303547.1 Gene:CG42813 / 43276 FlyBaseID:FBgn0261995 Length:212 Species:Drosophila melanogaster
Sequence 2:XP_008758411.1 Gene:Nudt8 / 361692 RGDID:1309040 Length:225 Species:Rattus norvegicus


Alignment Length:154 Identity:36/154 - (23%)
Similarity:51/154 - (33%) Gaps:59/154 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 LKEFPPAIGVTLELC--------------AGIVDKNKSWVEI---------------AREEVVEE 118
            |:..|.|..|.:.||              :.:|.::|..|..               |..|..||
  Rat    25 LRSRPAAAAVLVPLCLVRGVPALLYTLRSSRLVGRHKGEVSFPGGKCDPGDQDVIHTALRETQEE 89

  Fly   119 CGYDVPVERIEEVM--VYRSGVGSSGAKQTMYYCEVT-----DADKAT------GGGGVD----- 165
            .|.:|..|.:..|:  ||         .:..:...||     |..|||      ..|.:|     
  Rat    90 LGLEVSKEHVWGVLQPVY---------DRVSHPHPVTPSTPGDRRKATIVPVLANVGPLDLQSLR 145

  Fly   166 ---DEIIEVVELSLEEAKRMIQQG 186
               :|:.||.||||....:...||
  Rat   146 PNPEEVDEVFELSLAHLLQTQNQG 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42813NP_001303547.1 ADPRase_NUDT5 41..205 CDD:239516 36/154 (23%)
Nudt8XP_008758411.1 CoAse 31..201 CDD:239518 34/148 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.