DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42813 and Nudt5

DIOPT Version :9

Sequence 1:NP_001303547.1 Gene:CG42813 / 43276 FlyBaseID:FBgn0261995 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001007734.1 Gene:Nudt5 / 361274 RGDID:1359284 Length:219 Species:Rattus norvegicus


Alignment Length:182 Identity:45/182 - (24%)
Similarity:72/182 - (39%) Gaps:49/182 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LPQDSPYVKPFRLYYVQ-NGVEKNWDLLKV-------HDSVAII--LYNTSRQK-LVLVRQFRPA 65
            |..:..:||..:..|:. .|..:.|:.:|:       .|:|::|  |..|...: :|||:|||  
  Rat    22 LISEGKWVKFEKTTYMDPTGKTRTWETVKLTTRKGKSADAVSVIPVLQRTLHHECIVLVKQFR-- 84

  Fly    66 VYHGIISSAKGTFDEVDLKEFPPAIGVTLELCAGIVDKNKSWVEIAREEVVEECGYDVPVERIEE 130
                                 ||..|..||..||:::..:|....|..|:.||.||...:.....
  Rat    85 ---------------------PPMGGYCLEFPAGLIEDGESPEAAALRELEEETGYKGDIAECSP 128

  Fly   131 VMVYRSGVGSSGAKQTMYYCEVT-DADKATGGGGV-------DDEIIEVVEL 174
            .:....|:.:.    |.:...|| :.|.|   |.|       |.|.:||:.|
  Rat   129 AVCMDPGLSNC----TTHVVTVTINGDDA---GNVRPKPKPGDGEFVEVISL 173

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG42813NP_001303547.1 ADPRase_NUDT5 41..205 CDD:239516 38/145 (26%)