DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42813 and CG10195

DIOPT Version :9

Sequence 1:NP_001303547.1 Gene:CG42813 / 43276 FlyBaseID:FBgn0261995 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001260583.1 Gene:CG10195 / 35228 FlyBaseID:FBgn0032787 Length:361 Species:Drosophila melanogaster


Alignment Length:242 Identity:47/242 - (19%)
Similarity:81/242 - (33%) Gaps:78/242 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 NGVEKNWD--LLKVHDSVAIILYNT-----------------------------SRQKLVLVRQF 62
            :|..|::.  :||..|:.||.|..|                             :.::|||:|:.
  Fly    23 DGNNKDYKVLMLKRSDATAIALNQTVFPGGLLDSGADESVAWLHYLEEFGVPQEALRRLVLIRED 87

  Fly    63 RPAVYHGIISSAKGTFD-----------EVDL-----KEFPPAIGVTL-----------ELCAGI 100
            |||:   :.....|.:|           |:.|     :|....:|:.|           ..||..
  Fly    88 RPAI---LAPQGTGCYDRFFKRSRIWAREITLRLTAVRECFEEVGLLLCRSRSQLDFGAVTCAQA 149

  Fly   101 VDKNKSWVEIAREEVVE------ECGYDVPVERIEEVMVYRSGVGSSGAKQTMYYCEVTDADKAT 159
            |...:||......:..|      |......:..:.|...:.|........:|:::....|.....
  Fly   150 VPDLESWQRRVHNKPAEFLTLCRELNVVPDLWALHEWSAWASPGFIRKGHETVFFMAFVDKQPEL 214

  Fly   160 GGGGVDD--EIIEVVELSLEEAKRMIQQGAVNNSPP-----SCLMGL 199
                :::  |:.|.:.|:..|..|:...|.|...||     |.|||:
  Fly   215 ----LEEPSEVKETLWLTPVELLRLADLGNVWFMPPQVYELSRLMGI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42813NP_001303547.1 ADPRase_NUDT5 41..205 CDD:239516 43/228 (19%)
CG10195NP_001260583.1 NUDIX 10..237 CDD:278710 39/220 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0494
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.