DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42813 and Y92H12BL.5

DIOPT Version :9

Sequence 1:NP_001303547.1 Gene:CG42813 / 43276 FlyBaseID:FBgn0261995 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_740784.1 Gene:Y92H12BL.5 / 259365 WormBaseID:WBGene00022366 Length:150 Species:Caenorhabditis elegans


Alignment Length:112 Identity:19/112 - (16%)
Similarity:46/112 - (41%) Gaps:29/112 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 SVAIILYNTSRQKLVLVRQFRPAVYHGIISSAKGTFDEVDLKEFPPAIGVTLELCAGIVDKNKSW 107
            :.|:.:..|.::.|||           ::|..|.              |....:..|.::|::..
 Worm    27 AAALCIKGTGKETLVL-----------LVSGGKD--------------GGKWVVPGGGIEKDECA 66

  Fly   108 VEIAREEVVEECGYDVPVERIEEVMVYRSGVGSSGAKQTMYYCEVTD 154
            .|.|..|::||.|....:  ::::.:::..|...  :..::..||::
 Worm    67 EEAAHRELMEEAGVRATI--LKKIGMFQDDVRKH--RTQVFLMEVSE 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42813NP_001303547.1 ADPRase_NUDT5 41..205 CDD:239516 19/112 (17%)
Y92H12BL.5NP_740784.1 Nudix_Hydrolase_9 25..137 CDD:240024 19/112 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.