DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42813 and SPBP35G2.12

DIOPT Version :9

Sequence 1:NP_001303547.1 Gene:CG42813 / 43276 FlyBaseID:FBgn0261995 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_595387.1 Gene:SPBP35G2.12 / 2541356 PomBaseID:SPBP35G2.12 Length:205 Species:Schizosaccharomyces pombe


Alignment Length:109 Identity:31/109 - (28%)
Similarity:51/109 - (46%) Gaps:6/109 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 KEFPPAIG-VTLELCAGIVDKNKSWVEIAREEVVEECGYDVPVERIEEVMVYRSGVGSSGAKQTM 147
            |:|.|.|| ..:|:.||:||..:|..:.|..|:.||.||...|.....||....|:.::..|..:
pombe    74 KQFRPPIGKFCIEIPAGLVDSKESCEDAAIRELREETGYVGTVMDSTTVMYNDPGLTNANLKIIL 138

  Fly   148 YYCEVTDADKATGGGGVDD-EIIEVVELSL----EEAKRMIQQG 186
            ...:::..:.......:|| |.||...:.|    ||...:.::|
pombe   139 ADIDMSKPENQNPQQQLDDGEYIENFPIKLSSLQEELFSLEKKG 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42813NP_001303547.1 ADPRase_NUDT5 41..205 CDD:239516 31/109 (28%)
SPBP35G2.12NP_595387.1 ADPRase_NUDT5 54..197 CDD:239516 31/109 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.