DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42813 and ndx-8

DIOPT Version :10

Sequence 1:NP_733202.2 Gene:CG42813 / 43276 FlyBaseID:FBgn0261995 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_493372.1 Gene:ndx-8 / 190780 WormBaseID:WBGene00003585 Length:234 Species:Caenorhabditis elegans


Alignment Length:140 Identity:27/140 - (19%)
Similarity:46/140 - (32%) Gaps:60/140 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 YVQNGVEKNWDLL--------------KVHDSVAII------LYNTSRQKLVL---VRQFRPAVY 67
            |.:.||.:|.|.|              .:|.:||::      :.:....:.:.   :.||....:
 Worm    86 YEEVGVNENDDYLVLGNLPAFRARFGVLIHPTVALLRRPPTFVLSIGEVESIFWIPLSQFLEDTH 150

  Fly    68 HGIISSAKGTF--DE------VDLKEFPPAIGVTLELC----------------------AGIVD 102
            |       .||  ||      ....|:|...|||..:|                      :.::|
 Worm   151 H-------STFLIDEFYMVHVFQFDEYPTTYGVTALMCIVVAIGLLGKLPNFNLMGNLTISDMLD 208

  Fly   103 KNKSWVEIAR 112
            |:...:||.|
 Worm   209 KHLDSIEIIR 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42813NP_733202.2 NUDIX_UGPPase_Nudt14 26..206 CDD:467597 27/140 (19%)
ndx-8NP_493372.1 NUDIX_CoAse_Nudt7 30..180 CDD:467532 21/100 (21%)

Return to query results.
Submit another query.