DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42813 and NUDT3

DIOPT Version :9

Sequence 1:NP_001303547.1 Gene:CG42813 / 43276 FlyBaseID:FBgn0261995 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_006694.1 Gene:NUDT3 / 11165 HGNCID:8050 Length:172 Species:Homo sapiens


Alignment Length:123 Identity:24/123 - (19%)
Similarity:46/123 - (37%) Gaps:36/123 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 WL----GPLPQDSPYVKPFRLYYVQNGVEKNWDLLKVHDSVAIILYNTSRQKLVLVRQFRPAVYH 68
            |:    |..|::.|.|...|....:.||:.....|     |.|.    ..|:    |:.|..||.
Human    46 WIVPGGGMEPEEEPSVAAVREVCEEAGVKGTLGRL-----VGIF----ENQE----RKHRTYVYV 97

  Fly    69 GIISSAKGTFDEVDLKEFPPAIGVTLELCAGIVDKNKSWVEIAREEVVEECGYDVPVE 126
            .|::..        |:::..::.         :.:.:.|.:|  |:.::...|..||:
Human    98 LIVTEV--------LEDWEDSVN---------IGRKREWFKI--EDAIKVLQYHKPVQ 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42813NP_001303547.1 ADPRase_NUDT5 41..205 CDD:239516 15/86 (17%)
NUDT3NP_006694.1 Substrate binding. /evidence=ECO:0000269|PubMed:19585659, ECO:0007744|PDB:2FVV, ECO:0007744|PDB:2Q9P 18..20
Nudix_Hydrolase_9 19..131 CDD:240024 21/116 (18%)
Substrate binding. /evidence=ECO:0000269|PubMed:19585659, ECO:0007744|PDB:2FVV, ECO:0007744|PDB:2Q9P 39..41
Nudix box 51..72 5/20 (25%)
Substrate binding. /evidence=ECO:0000269|PubMed:19585659, ECO:0007744|PDB:2FVV, ECO:0007744|PDB:2Q9P 89..91 1/1 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.