DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42813 and Nudt19

DIOPT Version :9

Sequence 1:NP_001303547.1 Gene:CG42813 / 43276 FlyBaseID:FBgn0261995 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_149071.2 Gene:Nudt19 / 110959 MGIID:94203 Length:357 Species:Mus musculus


Alignment Length:118 Identity:27/118 - (22%)
Similarity:48/118 - (40%) Gaps:40/118 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KIWLGPLPQDSPYVKPFRLYYVQNGVEKNWDLLKVHDSVAIILYNTSRQKLVLVRQFRPAVYHGI 70
            :|||.| ||          :|....:| |:..|.     |:..:.:.|...| ..::.|.    |
Mouse   232 EIWLAP-PQ----------FYEMRRLE-NFASLS-----ALYRFCSDRPSEV-PEKWLPI----I 274

  Fly    71 ISSAKGTF-----DEVDLKEFPPAIGVTLELCAGIVDKNKSWVEIAREEVVEE 118
            :.::.||.     ||:.:|:            :..::||.| .:...||:|:|
Mouse   275 LLTSDGTIHLLPGDELYVKD------------SDFLEKNMS-TDKKTEEIVKE 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42813NP_001303547.1 ADPRase_NUDT5 41..205 CDD:239516 17/83 (20%)
Nudt19NP_149071.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 72..93
Nudix box 97..118
Microbody targeting signal. /evidence=ECO:0000255 355..357
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.