DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42813 and CG42814

DIOPT Version :9

Sequence 1:NP_001303547.1 Gene:CG42813 / 43276 FlyBaseID:FBgn0261995 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001189301.1 Gene:CG42814 / 10178958 FlyBaseID:FBgn0261996 Length:237 Species:Drosophila melanogaster


Alignment Length:210 Identity:115/210 - (54%)
Similarity:161/210 - (76%) Gaps:8/210 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VSKIWLGPLPQDSPYVKPFRLYYVQNGVEKNWDLLKVHDSVAIILYNTSRQKLVLVRQFRPAVYH 68
            :||||.||:|:||.::||.||:|::|.|||..|::|..|.|.:||||.:|:||:.|||||.|||.
  Fly    27 ISKIWFGPMPKDSNWIKPGRLHYIENDVEKQVDIIKTIDGVVVILYNKAREKLIFVRQFRGAVYQ 91

  Fly    69 GIISS-----AKGTFDEVDLKEFPPAIGVTLELCAGIVDKNKSWVEIAREEVVEECGYDVPVERI 128
            ||.|:     :||   |.||::|||.:|||||||.|.|||:||..|||:|||:|||||:||.|.:
  Fly    92 GIHSAGSPDMSKG---EADLEQFPPEVGVTLELCGGAVDKDKSLAEIAKEEVLEECGYEVPTESL 153

  Fly   129 EEVMVYRSGVGSSGAKQTMYYCEVTDADKATGGGGVDDEIIEVVELSLEEAKRMIQQGAVNNSPP 193
            :.|..||||:|:|.:..:::||||.||.|.:.|||:.:|.|:|:|:||||:::::|.||..|..|
  Fly   154 QHVYDYRSGIGTSSSAMSLFYCEVCDAQKVSAGGGIGEERIQVLEMSLEESRQLVQTGATTNGGP 218

  Fly   194 SCLMGLMWFFANRAP 208
            |||:||:|||.::||
  Fly   219 SCLLGLLWFFQHKAP 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42813NP_001303547.1 ADPRase_NUDT5 41..205 CDD:239516 93/168 (55%)
CG42814NP_001189301.1 ADPRase_NUDT5 65..230 CDD:239516 93/167 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450107
Domainoid 1 1.000 128 1.000 Domainoid score I5270
eggNOG 1 0.900 - - E1_COG0494
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 168 1.000 Inparanoid score I4126
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG59770
OrthoDB 1 1.010 - - D1164318at2759
OrthoFinder 1 1.000 - - FOG0006309
OrthoInspector 1 1.000 - - otm25202
orthoMCL 1 0.900 - - OOG6_106416
Panther 1 1.100 - - P PTHR11839
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6035
1211.810

Return to query results.
Submit another query.