DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Ser and PROZ

DIOPT Version :9

Sequence 1:	NP_001287558.1	Gene:	Ser / 43275	FlyBaseID:	FBgn0004197	Length:	1407	Species:	Drosophila melanogaster
Sequence 2:	XP_016876301.1	Gene:	PROZ / 8858	HGNCID:	9460	Length:	467	Species:	Homo sapiens

Alignment Length:	138	Identity:	35/138 - (25%)
Similarity:	58/138 - (42%)	Gaps:	14/138 - (10%)

- Green bases have known domain annotations that are detailed below.

  Fly   882 CRGQPCHNGGTCESGAGWFRCVCAQGFSGPDCRINVNECSPQPCQG-GATCIDGIGGYSCICPPG 945
            |..|||.:.|:|:.....:.|.|:.|:.|.:|.:..|||.|:...| ...|:.|...|:|.|..|
Human   158 CISQPCLHNGSCQDSIWGYTCTCSPGYEGSNCELAKNECHPERTDGCQHFCLPGQESYTCSCAQG 222

  Fly   946 RHGLRCEILLSDPKSACQNASNTISPYTALNRSQNWLDIALTGRTEDDENCNAC----VCEN--- 1003
            ..      |..|.|....:........|:..|:.:..|:....:..:.|..:.|    :.||
Human   223 YR------LGEDHKQCVPHDQCACGVLTSEKRAPDLQDLPWQVKLTNSEGKDFCGGVIIRENFVL 281

  Fly  1004 GTSRCTNL 1011
            .|::|:.|
Human   282 TTAKCSLL 289

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Ser	NP_001287558.1	MNNL	83..161	CDD:284966
		DSL	220..282	CDD:279722
		EGF_CA	350..388	CDD:238011
		EGF_CA	490..526	CDD:238011
		EGF_CA	610..645	CDD:238011
		EGF_CA	647..683	CDD:238011
		EGF_CA	798..833	CDD:238011
		EGF_CA	879..913	CDD:238011	10/30 (33%)
		EGF_CA	916..952	CDD:238011	11/36 (31%)
		VWC_out	<993..1053	CDD:214565	7/26 (27%)
PROZ	XP_016876301.1	None
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910