DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser and pros1

DIOPT Version :9

Sequence 1:NP_001287558.1 Gene:Ser / 43275 FlyBaseID:FBgn0004197 Length:1407 Species:Drosophila melanogaster
Sequence 2:NP_001119539.1 Gene:pros1 / 733989 XenbaseID:XB-GENE-980521 Length:673 Species:Xenopus tropicalis


Alignment Length:247 Identity:67/247 - (27%)
Similarity:90/247 - (36%) Gaps:89/247 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   492 DECAGGPCEHGG--TCIDLIGGFRCECPPEWHGDVCQVDVNECEAPHSAGIAANALLTTTATAII 554
            |:|...||...|  .|||..|.|.|.|.|.|.|.:|..|:||||.|    :..||          
 Frog   121 DQCTPLPCNRKGYKECIDGKGNFTCICKPGWQGPLCDKDINECEDP----VNRNA---------- 171

  Fly   555 GSNLSSTALLAALTSAVASTSLAIGPCINAKECRNQPGSFACICKEGWGGVTCAENLDDCVGQCR 619
            |.|                           ::|.|.|||:.|.|::|:             ....
 Frog   172 GCN---------------------------QKCLNLPGSYRCGCEDGY-------------YMLA 196

  Fly   620 NGATCIDLVNDYRCACASGFKGRDCETDIDECATSPCRNGGECVDMVGKFNCICPLGYSGS---- 680
            |..||.|              ..:||.....|.::.|:|      ..||:.|.|..|||.:    
 Frog   197 NKHTCND--------------RNECEMFPTICGSAVCKN------TPGKYECECDNGYSYNTSLK 241

  Fly   681 LCEEAKENCTPSPCLEGHCLNTPEGYYCHCPPDRAGK------HCEQLRPLC 726
            .||:..| |....|.: .|:|:|..|.|:|...|..|      .||.: |:|
 Frog   242 ACEDIDE-CADKSCSQ-VCVNSPGSYMCYCDGRRKYKLAQDQTSCESI-PVC 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SerNP_001287558.1 MNNL 83..161 CDD:284966
DSL 220..282 CDD:279722
EGF_CA 350..388 CDD:238011
EGF_CA 490..526 CDD:238011 15/35 (43%)
EGF_CA 610..645 CDD:238011 4/34 (12%)
EGF_CA 647..683 CDD:238011 10/39 (26%)
EGF_CA 798..833 CDD:238011
EGF_CA 879..913 CDD:238011
EGF_CA 916..952 CDD:238011
VWC_out <993..1053 CDD:214565
pros1NP_001119539.1 GLA 24..86 CDD:214503
EGF_CA 121..156 CDD:238011 15/34 (44%)
FXa_inhibition 168..201 CDD:291342 13/82 (16%)
EGF_CA 203..243 CDD:284955 13/59 (22%)
vWFA <241..281 CDD:294047 13/41 (32%)
LamG 315..457 CDD:238058
LamG 484..648 CDD:238058
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.