DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser and b3gat2

DIOPT Version :9

Sequence 1:NP_001287558.1 Gene:Ser / 43275 FlyBaseID:FBgn0004197 Length:1407 Species:Drosophila melanogaster
Sequence 2:NP_001025524.1 Gene:b3gat2 / 594928 XenbaseID:XB-GENE-921701 Length:331 Species:Xenopus tropicalis


Alignment Length:104 Identity:21/104 - (20%)
Similarity:37/104 - (35%) Gaps:15/104 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly  1283 RRYTNPLKGSTSSLRAATGMELSLNPAPELAASAASSSAL----------HRSQPLFPPCDFERE 1337
            |||..|:..:...:...||.......|.::|..|.|...:          ..|||.....||.::
 Frog   223 RRYERPVVENGKVVSWYTGWRADRPFAIDMAGFAVSLQVILSSPKAVFKRRGSQPGMQESDFLKQ 287

  Fly  1338 LDSSTGLKQAHKRSSQILLHKTQNSDMRKNTVGSLDSPR 1376
            :.....|:......:::|:..|     |...|...:.|:
 Frog   288 ITKVNELEPKANNCTKVLVWHT-----RTEKVNLANEPK 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SerNP_001287558.1 MNNL 83..161 CDD:284966
DSL 220..282 CDD:279722
EGF_CA 350..388 CDD:238011
EGF_CA 490..526 CDD:238011
EGF_CA 610..645 CDD:238011
EGF_CA 647..683 CDD:238011
EGF_CA 798..833 CDD:238011
EGF_CA 879..913 CDD:238011
EGF_CA 916..952 CDD:238011
VWC_out <993..1053 CDD:214565
b3gat2NP_001025524.1 GlcAT-I 81..313 CDD:132995 19/94 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.