DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser and Gas6

DIOPT Version :9

Sequence 1:NP_001287558.1 Gene:Ser / 43275 FlyBaseID:FBgn0004197 Length:1407 Species:Drosophila melanogaster
Sequence 2:NP_476441.2 Gene:Gas6 / 58935 RGDID:61913 Length:674 Species:Rattus norvegicus


Alignment Length:258 Identity:69/258 - (26%)
Similarity:92/258 - (35%) Gaps:105/258 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   486 TCEINI-DECAGGPCEHGGT--CIDLIGGFRCECPPEWHGDVCQVDVNECEAPHSAGIAANALLT 547
            ||..|: |:|...||:..||  |.||:|.|.|.|...|.|.:|..|||||...:           
  Rat   108 TCVKNLPDQCTPNPCDKKGTQLCQDLMGNFFCLCKDGWGGRLCDKDVNECSQKN----------- 161

  Fly   548 TTATAIIGSNLSSTALLAALTSAVASTSLAIGPCINAKECRNQPGSFACICKEGWGGVTCAENLD 612
                                           |.|  ::.|.|:||||                  
  Rat   162 -------------------------------GGC--SQVCHNKPGSF------------------ 175

  Fly   613 DCVGQCRNGATCIDLVNDYRCACASGFK----GRDCETDIDECATSPCRNGGECVDMVGKFNCIC 673
                               :|||.|||.    .:.|: |||||..|.......|.::.|.::|:|
  Rat   176 -------------------QCACHSGFSLQSDNKSCQ-DIDECTDSDTCGDARCKNLPGSYSCLC 220

  Fly   674 PLGYSGS----LCEEAKENCTPSPCLEGHCLNTPEGYYCHC--------PPDRAGKHCEQLRP 724
            ..||:.|    .|::..| |....| |..|:|:|..|.|||        .||.  ..||.:.|
  Rat   221 DKGYTYSSKEKTCQDVDE-CQQDRC-EQTCVNSPGSYTCHCNGRGGLKLSPDM--DTCEDILP 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SerNP_001287558.1 MNNL 83..161 CDD:284966
DSL 220..282 CDD:279722
EGF_CA 350..388 CDD:238011
EGF_CA 490..526 CDD:238011 16/38 (42%)
EGF_CA 610..645 CDD:238011 6/38 (16%)
EGF_CA 647..683 CDD:238011 13/39 (33%)
EGF_CA 798..833 CDD:238011
EGF_CA 879..913 CDD:238011
EGF_CA 916..952 CDD:238011
VWC_out <993..1053 CDD:214565
Gas6NP_476441.2 GLA 26..90 CDD:214503
EGF_CA 115..150 CDD:238011 15/34 (44%)
FXa_inhibition 157..192 CDD:291342 15/115 (13%)
EGF_CA 194..225 CDD:214542 11/30 (37%)
cEGF 215..238 CDD:289433 6/22 (27%)
FXa_inhibition 244..274 CDD:291342 11/32 (34%)
LamG 295..447 CDD:238058
Laminin_G_2 510..647 CDD:280389
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.