DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser and cue

DIOPT Version :9

Sequence 1:NP_001287558.1 Gene:Ser / 43275 FlyBaseID:FBgn0004197 Length:1407 Species:Drosophila melanogaster
Sequence 2:NP_612113.2 Gene:cue / 38174 FlyBaseID:FBgn0011204 Length:644 Species:Drosophila melanogaster


Alignment Length:151 Identity:46/151 - (30%)
Similarity:64/151 - (42%) Gaps:28/151 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   581 CINAKECRNQPGSFACICKEGWGGVTCAENLDDCVGQCRNGATCIDLVNDYRCACASGFKGRDCE 645
            |:|..|.|  ..:..|||..|:.|..|  .:.:|...|.:|...:..:...:|.|..||||..||
  Fly   373 CMNDGEYR--AATDLCICPTGFKGSRC--EIRECHNYCVHGTCQMSELAYPKCYCQPGFKGERCE 433

  Fly   646 TDIDECATSPCRNGGECVDMVGKF-----NCICPLGYSGSLCEE-AKENCTPSPCLEGHCLNTPE 704
            ..:   .:..|.|||.|  .|.|.     :|.||..:.|:.||: :.|.|:....|..|   .||
  Fly   434 LSV---CSGLCLNGGHC--RVSKDENEAPSCECPAKFGGARCEQNSTEICSLFCRLLKH---EPE 490

  Fly   705 GYY---CHCPPDRAGKHCEQL 722
            .|.   ||       ..||:|
  Fly   491 MYVPFGCH-------SICEEL 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SerNP_001287558.1 MNNL 83..161 CDD:284966
DSL 220..282 CDD:279722
EGF_CA 350..388 CDD:238011
EGF_CA 490..526 CDD:238011
EGF_CA 610..645 CDD:238011 9/34 (26%)
EGF_CA 647..683 CDD:238011 11/40 (28%)
EGF_CA 798..833 CDD:238011
EGF_CA 879..913 CDD:238011
EGF_CA 916..952 CDD:238011
VWC_out <993..1053 CDD:214565
cueNP_612113.2 LY 101..141 CDD:214531
Ldl_recept_b 167..208 CDD:278487
LY 193..237 CDD:214531
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24044
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.