DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser and C901

DIOPT Version :9

Sequence 1:NP_001287558.1 Gene:Ser / 43275 FlyBaseID:FBgn0004197 Length:1407 Species:Drosophila melanogaster
Sequence 2:NP_572673.1 Gene:C901 / 32032 FlyBaseID:FBgn0021742 Length:559 Species:Drosophila melanogaster


Alignment Length:711 Identity:158/711 - (22%)
Similarity:217/711 - (30%) Gaps:304/711 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 VLSDPGVGAIVLPFTFRWTKSFTLILQALDMYNTSYPDAERLIEETSYSGVILPSPEWKTLDHIG 227
            :|||.....:::      |....|.|:.::.|..:: ||    .::|.|.:    |.||      
  Fly     1 MLSDKKAALLLV------TAITALKLEEMNAYRRNF-DA----RQSSNSNI----PLWK------ 44

  Fly   228 RNARITYRVRVQCAVTYYNTTCTTFCRPRDDQFGHYACGSEGQKLCLNGWQGVNCEEAICKAGCD 292
                              ...|....:.|  |..||.|..:|...||.||||..|:..:|:.|||
  Fly    45 ------------------QRACEKSQKQR--QNAHYVCDEKGDFKCLPGWQGDLCQVPMCRRGCD 89

  Fly   293 PVHGKCDRPGECECRPGWRGPLCNECMVYPGCKHGSCNGSAWKCVCDTNWGGILCDQDLNFCGTH 357
            |::|.|.|||||.||.|:.|.||::|:..|||:||.|. ..::|:|...|.|:.|        |.
  Fly    90 PMNGYCQRPGECRCRIGYSGELCDKCIPLPGCQHGGCT-KPFECICKPGWAGLFC--------TE 145

  Fly   358 EPCKHG-----GTCENTAPDKYRCTCAEGLSGEQCEIVEHPCATRPCRNGGTCTLKTSNRTQAQV 417
            ..|:.|     |.||  ||.:  |.|..|.:|..|.    .|||.|....|||            
  Fly   146 PSCRTGCHSTRGYCE--APGE--CRCRIGYAGRTCS----ECATMPGCQHGTC------------ 190

  Fly   418 YRTSHGRSNMGRPVRRSSSMRSLDHLRPEGQALNGSSSPGLVSLGSLQLQQQLAPDFTCDCAAGW 482
                      .:|:.                                           |.|..|:
  Fly   191 ----------NKPLE-------------------------------------------CLCLPGY 202

  Fly   483 TGPTCEINI--DECA--GGPCEHGGTCIDLIGGFRCECPPEWHGDVCQ-------VDVNECEAPH 536
            ||..|:..|  .:|:  .|.|...|         .|.|...|.|..|.       ....:|||| 
  Fly   203 TGLLCQTPICDPDCSKQHGYCRKPG---------ECRCKVGWTGSQCDKCFPYPGCANGDCEAP- 257

  Fly   537 SAGIAANALLTTTATAIIGSNLSSTALLAALTSAVASTSLAIGPCINAKECRNQPGSFACICKEG 601
                                                                     :.|.|..|
  Fly   258 ---------------------------------------------------------WECNCHPG 265

  Fly   602 WGGVTCAENLDDCV---GQCRNGATCIDLVND---YRCACASGFKGRDCETDIDECATSPC---- 656
            |||:.|.|.|..||   ..|.||..|..|..:   |:|.|..||.|::||...|...||..    
  Fly   266 WGGMLCDEKLTYCVEHPDTCENGGKCTSLSREDGSYQCQCRQGFLGKNCEIRDDFLLTSEAPPRI 330

  Fly   657 -----------------RNGGECV------------DMVG------------KFNCICPLGYSGS 680
                             :||.:.:            .:||            |.:.:..:..:|:
  Fly   331 TPPTPAELVLELDGELDQNGQQDIGAGVPDDSEPGGGLVGEKLPAGNEPERRKNDTVANVATAGT 395

  Fly   681 -----------------------LCEEAKEN-------------CTPSPCLEGHCLNTPEGYYCH 709
                                   ..|...:|             .||.|...|.  .|.:|....
  Fly   396 GAGAGPMNSLPGNSNATRTTLVVATETGSDNATNEALSAVTTRRATPIPLTSGE--KTVKGNATS 458

  Fly   710 CPPDRAGKHCEQLRPLCSQPPCNEGCFANVSLATSATTTTTTTTTATT-----TRKMAKPS 765
            ......    .|.||........|...||::.|.:.|.|.||..||||     |....||:
  Fly   459 VSVATG----PQPRPPLPIVASQEQTIANLAPAGTVTVTATTAPTATTAATSVTSHKDKPN 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SerNP_001287558.1 MNNL 83..161 CDD:284966
DSL 220..282 CDD:279722 15/61 (25%)
EGF_CA 350..388 CDD:238011 12/42 (29%)
EGF_CA 490..526 CDD:238011 9/39 (23%)
EGF_CA 610..645 CDD:238011 14/40 (35%)
EGF_CA 647..683 CDD:238011 9/103 (9%)
EGF_CA 798..833 CDD:238011
EGF_CA 879..913 CDD:238011
EGF_CA 916..952 CDD:238011
VWC_out <993..1053 CDD:214565
C901NP_572673.1 DSL <56..79 CDD:302925 11/22 (50%)
EGF_CA 280..315 CDD:238011 11/34 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D46730at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24044
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.