DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser and GAS6

DIOPT Version :9

Sequence 1:NP_001287558.1 Gene:Ser / 43275 FlyBaseID:FBgn0004197 Length:1407 Species:Drosophila melanogaster
Sequence 2:NP_000811.1 Gene:GAS6 / 2621 HGNCID:4168 Length:678 Species:Homo sapiens


Alignment Length:271 Identity:74/271 - (27%)
Similarity:99/271 - (36%) Gaps:97/271 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   477 DCAAGWTGP--------TCEINI-DECAGGPCEHGGT--CIDLIGGFRCECPPEWHGDVCQVDVN 530
            ||...:..|        ||..|: |:|...||:..||  |.||:|.|.|.|...|.|.:|..|||
Human    94 DCINKYGSPYTKNSGFATCVQNLPDQCTPNPCDRKGTQACQDLMGNFFCLCKAGWGGRLCDKDVN 158

  Fly   531 ECEAPHSAGIAANALLTTTATAIIGSNLSSTALLAALTSAVASTSLAIGPCINAKECRNQPGSFA 595
            ||...:                                          |.|:..  |.|:||||.
Human   159 ECSQEN------------------------------------------GGCLQI--CHNKPGSFH 179

  Fly   596 CICKEGWGGVTCAENLDDCVGQCRNGATCIDLVNDYRCACASGFKGRDCETDIDECATSPCRNGG 660
            |.|..|:                       :|.:|          ||.|: ||||||.|......
Human   180 CSCHSGF-----------------------ELSSD----------GRTCQ-DIDECADSEACGEA 210

  Fly   661 ECVDMVGKFNCICPLGYSGSLCEEAKENCTPSPCLEGH----CLNTPEGYYCHCPPDRAGKHCEQ 721
            .|.::.|.::|:|..|::.|..|:|..:.  ..||:|.    |:|:|..|.||| ..|.|....|
Human   211 RCKNLPGSYSCLCDEGFAYSSQEKACRDV--DECLQGRCEQVCVNSPGSYTCHC-DGRGGLKLSQ 272

  Fly   722 LRPLCSQ-PPC 731
            ....|.. .||
Human   273 DMDTCEDILPC 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SerNP_001287558.1 MNNL 83..161 CDD:284966
DSL 220..282 CDD:279722
EGF_CA 350..388 CDD:238011
EGF_CA 490..526 CDD:238011 16/38 (42%)
EGF_CA 610..645 CDD:238011 4/34 (12%)
EGF_CA 647..683 CDD:238011 13/35 (37%)
EGF_CA 798..833 CDD:238011
EGF_CA 879..913 CDD:238011
EGF_CA 916..952 CDD:238011
VWC_out <993..1053 CDD:214565
GAS6NP_000811.1 Gla 53..92 CDD:306960
EGF_CA 118..153 CDD:238011 15/34 (44%)
FXa_inhibition 160..195 CDD:317114 16/111 (14%)
EGF_CA 197..>227 CDD:214542 11/29 (38%)
vWFA <232..273 CDD:320736 14/43 (33%)
LamG 298..450 CDD:238058
Laminin_G_2 513..651 CDD:308045
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.