DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser and Egfl7

DIOPT Version :9

Sequence 1:NP_001287558.1 Gene:Ser / 43275 FlyBaseID:FBgn0004197 Length:1407 Species:Drosophila melanogaster
Sequence 2:XP_006233730.1 Gene:Egfl7 / 245963 RGDID:708507 Length:282 Species:Rattus norvegicus


Alignment Length:301 Identity:79/301 - (26%)
Similarity:103/301 - (34%) Gaps:93/301 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 IEETSYSGVILPSPEWKTLDHIGRNARITYRV--RVQCAVTYYNTTCTTFCRPRDDQFGHYACGS 267
            |.||....|.  .|...|.|  |..|..|||.  |....:.|.::...|..|||      |||  
  Rat    44 ISETFVQRVY--QPYLTTCD--GHRACSTYRTIYRTAYRIAYRHSPGLTPSRPR------YAC-- 96

  Fly   268 EGQKLCLNGWQGVN-----CEEAICKAGCDPVHGKCDRPGECECRPGWRGPLCNECMVYPGCKHG 327
                 | .||:..|     |..|||:..|.. .|.|.|||.|.|..||:|               
  Rat    97 -----C-PGWKRTNGLPGACGAAICQPPCGN-EGSCIRPGRCRCPVGWQG--------------- 139

  Fly   328 SCNGSAWKCVCDTNWGGILCDQDLNFCGTHEP-CKHGGTCENTAPDKYRCTCAEGLS----GEQC 387
                       ||      |..|::.|.|.|. |..  .|.||. ..|.|.|.||.|    |..|
  Rat   140 -----------DT------CQIDVDECSTGEARCPQ--RCVNTV-GSYWCQCWEGQSPSADGVLC 184

  Fly   388 EIVEHPCATRPCRNGGTCTLKTSNRTQAQVYRTSHGRSNMGRPVRR-SSSMRSLDHLRPEGQALN 451
            ...|.|....|....|..::     .:.:||:.......:.:.::. .:.:.||....||    :
  Rat   185 LPKEGPSPVAPSPTPGVDSV-----VREEVYKLQARVDVLEQKLQLVLAPLHSLASRSPE----H 240

  Fly   452 GSSSPGLVSLGSLQ--------------LQQQLAPDFTCDC 478
            |...||.:...|.|              |::||.   :|.|
  Rat   241 GLQDPGSLLAHSFQQLDRIDSLSEQVSFLEEQLG---SCSC 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SerNP_001287558.1 MNNL 83..161 CDD:284966
DSL 220..282 CDD:279722 20/68 (29%)
EGF_CA 350..388 CDD:238011 15/42 (36%)
EGF_CA 490..526 CDD:238011
EGF_CA 610..645 CDD:238011
EGF_CA 647..683 CDD:238011
EGF_CA 798..833 CDD:238011
EGF_CA 879..913 CDD:238011
EGF_CA 916..952 CDD:238011
VWC_out <993..1053 CDD:214565
Egfl7XP_006233730.1 EMI 32..101 CDD:400092 23/74 (31%)
EGF_CA 145..184 CDD:311536 15/41 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.