DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser and egas-1

DIOPT Version :9

Sequence 1:NP_001287558.1 Gene:Ser / 43275 FlyBaseID:FBgn0004197 Length:1407 Species:Drosophila melanogaster
Sequence 2:NP_001359624.1 Gene:egas-1 / 180219 WormBaseID:WBGene00013486 Length:922 Species:Caenorhabditis elegans


Alignment Length:587 Identity:151/587 - (25%)
Similarity:215/587 - (36%) Gaps:158/587 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   535 PHSAGIAANALLTTTATAIIGSNLSSTALLAALTSAVASTSLAIGPCINAKECRNQPGSFACICK 599
            ||.   .||..|.|..|                |:.|:||::::   |....|  .|.:  |.|.
 Worm    30 PHG---CANYGLCTDVT----------------TTLVSSTNISV---IYEYGC--DPDN--CYCL 68

  Fly   600 EG-WGGVTCAENLDDCVGQCRNGA-------TCIDLVNDYRCACASGFKGRDCETDI-DECATSP 655
            || ..|....:.::|   ||.|..       .|...:..|.|:|..||.|.||:::: ..|||||
 Worm    69 EGTTNGTEPCDTIED---QCGNNPCGDPKYFLCTSKIKSYSCSCKPGFTGNDCKSELGSACATSP 130

  Fly   656 CRNGGEC--VD-MVGKFNCICPLGYSGSLCEEAKENCTPSPCLEGHCLNTPE--GYYCHCPPDRA 715
            ||:|..|  || ....:.|||.....|..||.......|.....|:|....:  .:.|.|||...
 Worm   131 CRSGATCESVDNSTAGYKCICKWNQMGENCEYDNFCANPQCQNNGNCSMVVDNANWICSCPPGWQ 195

  Fly   716 GKHCEQLRPLCSQPPCNEGCFANVSLATSATTT----------------------TTTTTTATTT 758
            |:.|| .....:.||..:||:.....:..||||                      |.|....|..
 Worm   196 GRRCE-TPDTVTTPPVWDGCYKYNFQSIGATTTKFSDNQLTVDKCNKYALQQSSDTVTMNYLTLC 259

  Fly   759 RKMAKPSGLP---------------CSGH-----------------GSCEMS----DVGTFCKCH 787
            ......|..|               |.|:                 |:.|:.    |..|||...
 Worm   260 GGFCMVSEGPLCNDTSNWDDDCKKKCGGNNNEFCGVLNKRCIVYEAGTAEVDENACDNSTFCSAD 324

  Fly   788 VGH----------------------TGTFCEHNLNE-CSPNPCRNGGICL-DGDGDFTCECMSGW 828
            :|.                      ||..||:.:.| |:|:||.||...| |....|||.|..|:
 Worm   325 LGQGLCINWQSDFTDGYACICKPLWTGRNCENPVPEACTPSPCLNGTCVLNDQYNKFTCVCDDGF 389

  Fly   829 TGKRCSERATGCYAGQCQNGGTC--MPGAPDKALQPHCRCAPGWTGLFCAEAIDQC-RGQPCHNG 890
            .|.:| :.:..|.:..|..||||  :.....|     |.|...:.|..| |.|::| .|:||:||
 Worm   390 FGDKC-QYSDICTSATCLYGGTCTELNNGDYK-----CDCLLQYFGKNC-EVINRCDYGKPCNNG 447

  Fly   891 ---GTCESGAGWFRCVCAQGFSGPDCRINVNECSPQPCQGGATCIDGIGGYSCICPPGRHGLRCE 952
               .|.:.....:.|.|..|::|.:|...::.|.|.||...:||.....||.|.|..|..|:.|.
 Worm   448 KCASTIDGITTNYTCTCDDGWTGTNCDTMIDFCIPNPCSYNSTCKPKFKGYDCTCITGLTGVNCS 512

  Fly   953 ILLSDPKSACQNASNTISPYTALNRSQNWLDIALTGRTEDDENC----NACVCENGTSRCTNLWC 1013
            .::           :...||.  :.:..|:......: :|..||    |...|..| .:.|:..|
 Worm   513 TII-----------DLCVPYK--DSTGKWIKTPCNSK-DDMANCTKGINTLTCSCG-DKWTDTLC 562

  Fly  1014 GL 1015
            .|
 Worm   563 DL 564

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SerNP_001287558.1 MNNL 83..161 CDD:284966
DSL 220..282 CDD:279722
EGF_CA 350..388 CDD:238011
EGF_CA 490..526 CDD:238011
EGF_CA 610..645 CDD:238011 12/41 (29%)
EGF_CA 647..683 CDD:238011 15/39 (38%)
EGF_CA 798..833 CDD:238011 15/36 (42%)
EGF_CA 879..913 CDD:238011 12/37 (32%)
EGF_CA 916..952 CDD:238011 12/35 (34%)
VWC_out <993..1053 CDD:214565 8/27 (30%)
egas-1NP_001359624.1 deg-1 <595..908 CDD:273309
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.