DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Ser and F9

DIOPT Version :9

Sequence 1:	NP_001287558.1	Gene:	Ser / 43275	FlyBaseID:	FBgn0004197	Length:	1407	Species:	Drosophila melanogaster
Sequence 2:	NP_032005.1	Gene:	F9 / 14071	MGIID:	88384	Length:	471	Species:	Mus musculus

Alignment Length:	113	Identity:	35/113 - (30%)
Similarity:	51/113 - (45%)	Gaps:	18/113 - (15%)

- Green bases have known domain annotations that are detailed below.

  Fly   647 DIDECATSPCRNGGECVDMVGKFNCICPLGYSGSLCE-EAKENCTPSPCLEGHCLNTPEG-YYCH 709
            |.|:|.::||.|||.|.|.:..:.|.|.:|:.|..|| :|..|.....|.: .|.|:|:. ..|.
Mouse    93 DGDQCESNPCLNGGICKDDISSYECWCQVGFEGRNCELDATCNIKNGRCKQ-FCKNSPDNKVICS 156

  Fly   710 C------PPDRAGKHCEQLRPLCSQPPCNEGCFANVSLATSATTTTTT 751
            |      ..|:  |.||...|.    ||..   |::|.::...|...|
Mouse   157 CTEGYQLAEDQ--KSCEPTVPF----PCGR---ASISYSSKKITRAET 195

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Ser	NP_001287558.1	MNNL	83..161	CDD:284966
		DSL	220..282	CDD:279722
		EGF_CA	350..388	CDD:238011
		EGF_CA	490..526	CDD:238011
		EGF_CA	610..645	CDD:238011
		EGF_CA	647..683	CDD:238011	14/35 (40%)
		EGF_CA	798..833	CDD:238011
		EGF_CA	879..913	CDD:238011
		EGF_CA	916..952	CDD:238011
		VWC_out	<993..1053	CDD:214565
F9	NP_032005.1	GLA	28..92	CDD:214503
		EGF_CA	93..129	CDD:238011	14/35 (40%)
		FXa_inhibition	134..170	CDD:291342	9/38 (24%)
		Tryp_SPc	236..464	CDD:214473
		Tryp_SPc	237..467	CDD:238113
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910