DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser and FBLN7

DIOPT Version :9

Sequence 1:NP_001287558.1 Gene:Ser / 43275 FlyBaseID:FBgn0004197 Length:1407 Species:Drosophila melanogaster
Sequence 2:XP_011508887.1 Gene:FBLN7 / 129804 HGNCID:26740 Length:453 Species:Homo sapiens


Alignment Length:412 Identity:101/412 - (24%)
Similarity:146/412 - (35%) Gaps:127/412 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   428 GRPVRRSSSMRSLDHLRPEGQALNGS-----------SSPGLVS------LGSLQLQQQLAPDFT 475
            |:..|.:..:|   |::....||..|           |.|.|.:      .||..|... ...||
Human    46 GQETRFAEGIR---HMKSRLAALQNSVGRVGPDALPVSCPALNTPADGRKFGSKYLVDH-EVHFT 106

  Fly   476 CD------------CAAG--WTG--PTCEINIDECAGGPCEHGGTCIDLIGGFRCECPPEWHGDV 524
            |:            |...  |||  |.|. .|.||:..||::||||::.:..:||.|||...|:.
Human   107 CNPGFRLVGPSSVVCLPNGTWTGEQPHCR-GISECSSQPCQNGGTCVEGVNQYRCICPPGRTGNR 170

  Fly   525 CQVDVNECEAPHSAGIAANALLTTTATAIIGSNLSSTALLAALTSAVASTSLAIGPCINAKECRN 589
            ||         |.|..||      ...::.|.:..|                      .|..|..
Human   171 CQ---------HQAQTAA------PEGSVAGDSAFS----------------------RAPRCAQ 198

  Fly   590 QPGSFACICKEGW-----GGVTCAENLDDC--VGQ------CRNGATCIDLVNDYRCACASGFK- 640
            ...:..|.|:.|:     .|.:..:::::|  .||      |.:  .|::....|||.|..|:: 
Human   199 VERAQHCSCEAGFHLSGAAGDSVCQDVNECELYGQEGRPRLCMH--ACVNTPGSYRCTCPGGYRT 261

  Fly   641 ---GRDCETDIDEC-ATSP-CRNGGECVDMVGKFNCICPLGYSGSLCEEAKENCTPSPCLEGHCL 700
               |:.|| |:||| ...| |..|..|::..|.|.|:.|      .|.|...|.:........|.
Human   262 LADGKSCE-DVDECVGLQPVCPQGTTCINTGGSFQCVSP------ECPEGSGNVSYVKTSPFQCE 319

  Fly   701 NTPEGYYCHCPPDRAGKHCEQLRPLCSQPPCNEGCFANVSLATSATTTTTTTTTATTTRK-MAKP 764
            ..|      ||.|  .:.|..|....|        |..:||.::..|..|....||.:.. .|.|
Human   320 RNP------CPMD--SRPCRHLPKTIS--------FHYLSLPSNLKTPITLFRMATASAPGRAGP 368

  Fly   765 SGL-------PCSGHGSCEMSD 779
            :.|       ...||...:.||
Human   369 NSLRFGIVGGNSRGHFVMQRSD 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SerNP_001287558.1 MNNL 83..161 CDD:284966
DSL 220..282 CDD:279722
EGF_CA 350..388 CDD:238011
EGF_CA 490..526 CDD:238011 15/35 (43%)
EGF_CA 610..645 CDD:238011 11/46 (24%)
EGF_CA 647..683 CDD:238011 12/37 (32%)
EGF_CA 798..833 CDD:238011
EGF_CA 879..913 CDD:238011
EGF_CA 916..952 CDD:238011
VWC_out <993..1053 CDD:214565
FBLN7XP_011508887.1 CCP 81..135 CDD:153056 13/54 (24%)
EGF_CA 137..172 CDD:238011 15/34 (44%)
EGF_CA 224..269 CDD:214542 11/46 (24%)
EGF_CA 270..307 CDD:284955 14/42 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I11308
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.