DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser and AgaP_AGAP010940

DIOPT Version :9

Sequence 1:NP_001287558.1 Gene:Ser / 43275 FlyBaseID:FBgn0004197 Length:1407 Species:Drosophila melanogaster
Sequence 2:XP_309755.4 Gene:AgaP_AGAP010940 / 1271013 VectorBaseID:AGAP010940 Length:340 Species:Anopheles gambiae


Alignment Length:400 Identity:115/400 - (28%)
Similarity:146/400 - (36%) Gaps:151/400 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 DQFGHYACGSEGQKLCLNGWQGVNCEEAICKAGCDPVHGKCDRPGECECRPGWRGPLCNECMVYP 322
            :::.||.|...|...||.||.|..|:..|||.||||:.|.|.|||||.|:.|:.|..||.|:..|
Mosquito    14 NEYSHYVCDDNGDVKCLPGWTGDLCDVPICKKGCDPLQGYCKRPGECRCKLGFYGENCNRCIPLP 78

  Fly   323 GCKHGSCNGSAWKCVCDTNWGGILCDQDLNFCGTHEPCKHGGTCENTAPDKYRCTCAEGLSGEQC 387
            ||:||.|..| ::|||...|.||.|.:.:.....| |.:  |.||  ||.:  |.|..|.:|..|
Mosquito    79 GCQHGGCQVS-FECVCHKGWDGIFCSEPICRSDCH-PSR--GYCE--APGE--CRCRLGWAGPTC 135

  Fly   388 EIVEHPCATRPCRNGGTCTLKTSNRTQAQVYRTSHGRSNMGRPVRRSSSMRSLDHLRPEGQALNG 452
                ..|...|....||||                      :|:.                    
Mosquito   136 ----RDCQVLPGCMHGTCT----------------------KPLE-------------------- 154

  Fly   453 SSSPGLVSLGSLQLQQQLAPDFTCDCAAGWTGPTCEINIDECAG------GPCEHGGTCIDLIGG 511
                                   |.|..||||..|:..|  ||.      |.|...|        
Mosquito   155 -----------------------CKCLPGWTGILCQTPI--CAANCSREHGYCRRPG-------- 186

  Fly   512 FRCECPPEWHGDVCQVDVNECEAPHSAGIAANALLTTTATAIIGSNLSSTALLAALTSAVASTSL 576
             .|.|...|.|..|    |:|. |:..                                      
Mosquito   187 -ECRCKVGWMGQEC----NKCH-PYPG-------------------------------------- 207

  Fly   577 AIGPCINAKECRNQPGSFACICKEGWGGVTCAENLDDC---VGQCRNGATCIDLVND---YRCAC 635
                |:|. :||.   .:.|.||.||||:.|.|.|:.|   ...|:||..|..::.|   |||.|
Mosquito   208 ----CVNG-DCRR---PWECNCKPGWGGMLCDEELNYCEQNPDTCQNGGKCKSVIKDDGHYRCEC 264

  Fly   636 ASGFKGRDCE 645
            .||:|||:||
Mosquito   265 PSGYKGRNCE 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SerNP_001287558.1 MNNL 83..161 CDD:284966
DSL 220..282 CDD:279722 9/23 (39%)
EGF_CA 350..388 CDD:238011 11/37 (30%)
EGF_CA 490..526 CDD:238011 10/41 (24%)
EGF_CA 610..645 CDD:238011 16/40 (40%)
EGF_CA 647..683 CDD:238011
EGF_CA 798..833 CDD:238011
EGF_CA 879..913 CDD:238011
EGF_CA 916..952 CDD:238011
VWC_out <993..1053 CDD:214565
AgaP_AGAP010940XP_309755.4 DSL <16..38 CDD:302925 9/21 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D46730at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.