DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser and NOTCH2NLC

DIOPT Version :9

Sequence 1:NP_001287558.1 Gene:Ser / 43275 FlyBaseID:FBgn0004197 Length:1407 Species:Drosophila melanogaster
Sequence 2:NP_001350942.1 Gene:NOTCH2NLC / 100996717 HGNCID:53924 Length:293 Species:Homo sapiens


Alignment Length:291 Identity:95/291 - (32%)
Similarity:121/291 - (41%) Gaps:43/291 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   724 PLCSQPPCNEGCFANVSLATSATTTTTTTTTATTTRKMAKPSGLPCSGHGSCEMSDVGT-FCKCH 787
            |||.......||                   |....:|.:....||...|.|.....|| :|||.
Human    27 PLCCGRCWRSGC-------------------AARPPRMCRDGYEPCVNEGMCVTYHNGTGYCKCP 72

  Fly   788 VGHTGTFCEHNLNECSPNPCRNGGICLDGD--GDFTCECMSGWTGKRCS-ERATGCYAGQ-CQNG 848
            .|..|.:|:|. :.|..|.|:|||.|:...  |..||.|.||:||:.|. ..:..|:..: |.||
Human    73 EGFLGEYCQHR-DPCEKNRCQNGGTCVAQAMLGKATCRCASGFTGEDCQYSTSHPCFVSRPCLNG 136

  Fly   849 GTCMPGAPDKALQPHCRCAPGWTGLFCAEAIDQCRGQPCHNGGTCESGAGWFRCVCAQGFSGPDC 913
            |||...:.|..   .|.|..|:||..| :..|.|...||.||.||.:.|..|.|.|..||:|..|
Human   137 GTCHMLSRDTY---ECTCQVGFTGKEC-QWTDACLSHPCANGSTCTTVANQFSCKCLTGFTGQKC 197

  Fly   914 RINVNECS-PQPCQGGATCIDGIGGYSCICPPGRHGLRCEIL-LSDPKSACQNASN--------- 967
            ..:||||. |..||.|.||::..|.|.|.|..|..|..|:.| :....|.|.|...         
Human   198 ETDVNECDIPGHCQHGGTCLNLPGSYQCQCLQGFTGQYCDSLYVPCAPSPCVNGGTCRQTGDFTF 262

  Fly   968 --TISPYTALNRSQNW-LDIALTGRTEDDEN 995
              ...|.|....::.| .|..:....|.|||
Human   263 ECNCLPETVRRGTELWERDREVWNGKEHDEN 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SerNP_001287558.1 MNNL 83..161 CDD:284966
DSL 220..282 CDD:279722
EGF_CA 350..388 CDD:238011
EGF_CA 490..526 CDD:238011
EGF_CA 610..645 CDD:238011
EGF_CA 647..683 CDD:238011
EGF_CA 798..833 CDD:238011 15/36 (42%)
EGF_CA 879..913 CDD:238011 15/33 (45%)
EGF_CA 916..952 CDD:238011 16/36 (44%)
VWC_out <993..1053 CDD:214565 3/3 (100%)
NOTCH2NLCNP_001350942.1 EGF_CA 200..236 CDD:238011 16/35 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.