DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser and EDIL3

DIOPT Version :9

Sequence 1:NP_001287558.1 Gene:Ser / 43275 FlyBaseID:FBgn0004197 Length:1407 Species:Drosophila melanogaster
Sequence 2:NP_005702.3 Gene:EDIL3 / 10085 HGNCID:3173 Length:480 Species:Homo sapiens


Alignment Length:203 Identity:67/203 - (33%)
Similarity:81/203 - (39%) Gaps:62/203 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   802 CSPNPCRNGGICLDG--DGDFTCECMSGWTGKRCS---------ERATGCYAGQCQNGGTCMPGA 855
            |.||||.||||||.|  ||.|:|||..|:|...||         |..|        :.|.|.|  
Human    26 CDPNPCENGGICLPGLADGSFSCECPDGFTDPNCSSVVEVASDEEEPT--------SAGPCTP-- 80

  Fly   856 PDKALQPHCRCAPGWTGLFCAEAIDQCRGQPCHNGGTCESGAGW-------FRCVCAQGFSGPDC 913
                                         .|||||||||....:       :.|.|.:||:|..|
Human    81 -----------------------------NPCHNGGTCEISEAYRGDTFIGYVCKCPRGFNGIHC 116

  Fly   914 RINVNECSPQPCQGGATCIDGIGGYSCICPPGRHGLRCEILLSDP----KSACQNASNTI-SPYT 973
            :.|:|||..:||:.|..|.|.:..|||.||....|..|:...|.|    .....|...|. |.:.
Human   117 QHNINECEVEPCKNGGICTDLVANYSCECPGEFMGRNCQYKCSGPLGIEGGIISNQQITASSTHR 181

  Fly   974 ALNRSQNW 981
            ||...|.|
Human   182 ALFGLQKW 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SerNP_001287558.1 MNNL 83..161 CDD:284966
DSL 220..282 CDD:279722
EGF_CA 350..388 CDD:238011
EGF_CA 490..526 CDD:238011
EGF_CA 610..645 CDD:238011
EGF_CA 647..683 CDD:238011
EGF_CA 798..833 CDD:238011 20/32 (63%)
EGF_CA 879..913 CDD:238011 14/40 (35%)
EGF_CA 916..952 CDD:238011 15/35 (43%)
VWC_out <993..1053 CDD:214565
EDIL3NP_005702.3 EGF_CA 27..59 CDD:238011 19/31 (61%)
EGF_CA 79..117 CDD:238011 15/68 (22%)
Cell attachment site (Potential) 96..98 0/1 (0%)
EGF_CA 119..155 CDD:238011 15/35 (43%)
FA58C 157..314 CDD:214572 9/33 (27%)
FA58C 160..313 CDD:238014 8/30 (27%)
FA58C 318..476 CDD:214572
FA58C 321..475 CDD:238014
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I11681
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.