| Sequence 1: | NP_001287558.1 | Gene: | Ser / 43275 | FlyBaseID: | FBgn0004197 | Length: | 1407 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_002936721.3 | Gene: | ccbe1 / 100495021 | XenbaseID: | XB-GENE-920172 | Length: | 394 | Species: | Xenopus tropicalis |
| Alignment Length: | 202 | Identity: | 53/202 - (26%) |
|---|---|---|---|
| Similarity: | 73/202 - (36%) | Gaps: | 59/202 - (29%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 614 CVGQCRNGATCIDLVNDYRCACASGFK---GRDCETDIDECATSPCRNGGECVDMVGKFNCICPL 675
Fly 676 GYSGSLCEEAKENCTPSP-CLE------------GH-CLNTPEGYYCHCPP----DRAGKHC--- 719
Fly 720 -----EQLRPLCSQPPCNEGC------------------FANVSLATSATTTTTTTTTATTTRKM 761
Fly 762 AKPSGLP 768 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Ser | NP_001287558.1 | MNNL | 83..161 | CDD:284966 | |
| DSL | 220..282 | CDD:279722 | |||
| EGF_CA | 350..388 | CDD:238011 | |||
| EGF_CA | 490..526 | CDD:238011 | |||
| EGF_CA | 610..645 | CDD:238011 | 10/33 (30%) | ||
| EGF_CA | 647..683 | CDD:238011 | 13/35 (37%) | ||
| EGF_CA | 798..833 | CDD:238011 | |||
| EGF_CA | 879..913 | CDD:238011 | |||
| EGF_CA | 916..952 | CDD:238011 | |||
| VWC_out | <993..1053 | CDD:214565 | |||
| ccbe1 | XP_002936721.3 | EGF_CA | 126..167 | CDD:214542 | 11/40 (28%) |
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||