Sequence 1: | NP_001287558.1 | Gene: | Ser / 43275 | FlyBaseID: | FBgn0004197 | Length: | 1407 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_002936721.3 | Gene: | ccbe1 / 100495021 | XenbaseID: | XB-GENE-920172 | Length: | 394 | Species: | Xenopus tropicalis |
Alignment Length: | 202 | Identity: | 53/202 - (26%) |
---|---|---|---|
Similarity: | 73/202 - (36%) | Gaps: | 59/202 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 614 CVGQCRNGATCIDLVNDYRCACASGFK---GRDCETDIDECATSPCRNGGECVDMVGKFNCICPL 675
Fly 676 GYSGSLCEEAKENCTPSP-CLE------------GH-CLNTPEGYYCHCPP----DRAGKHC--- 719
Fly 720 -----EQLRPLCSQPPCNEGC------------------FANVSLATSATTTTTTTTTATTTRKM 761
Fly 762 AKPSGLP 768 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ser | NP_001287558.1 | MNNL | 83..161 | CDD:284966 | |
DSL | 220..282 | CDD:279722 | |||
EGF_CA | 350..388 | CDD:238011 | |||
EGF_CA | 490..526 | CDD:238011 | |||
EGF_CA | 610..645 | CDD:238011 | 10/33 (30%) | ||
EGF_CA | 647..683 | CDD:238011 | 13/35 (37%) | ||
EGF_CA | 798..833 | CDD:238011 | |||
EGF_CA | 879..913 | CDD:238011 | |||
EGF_CA | 916..952 | CDD:238011 | |||
VWC_out | <993..1053 | CDD:214565 | |||
ccbe1 | XP_002936721.3 | EGF_CA | 126..167 | CDD:214542 | 11/40 (28%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |