DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser and ankle2

DIOPT Version :9

Sequence 1:NP_001287558.1 Gene:Ser / 43275 FlyBaseID:FBgn0004197 Length:1407 Species:Drosophila melanogaster
Sequence 2:XP_004910629.2 Gene:ankle2 / 100380184 XenbaseID:XB-GENE-948912 Length:996 Species:Xenopus tropicalis


Alignment Length:179 Identity:41/179 - (22%)
Similarity:54/179 - (30%) Gaps:51/179 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   674 PLGYSGSLCEEAKENC--TPSPCL--EGHCLNTPEGYYCHCPPDRAGKHCEQLRPLCSQPPCNEG 734
            |..|....|....|.|  .|.|||  ...||..||.  |..||:.           |..||  |.
 Frog    45 PCLYPPEPCLYPPEPCLYPPEPCLYPPEPCLYPPEP--CLYPPEP-----------CLYPP--EP 94

  Fly   735 CFANVSLATSATTTTTTTTTATTTRKMAKP---------SGLPCSGHGS---------------- 774
            |.:....||.......:.....:..|:..|         :||.|....|                
 Frog    95 CLSAPRPATEVQLVAQSMDNILSQLKLLNPDQLREEILKAGLKCGPITSTTRFIFEKKLARVLLE 159

  Fly   775 ---CEMSDVGTFCKCHVGHTGTFCEHNLNECSPNPCRNGGICLDGDGDF 820
               ..:.:..|.|..:.|.:|.....|....:....:|   ||: ||||
 Frog   160 QQGVNLEETTTVCDGNAGASGNAGTDNRQHTNYTQKKN---CLE-DGDF 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SerNP_001287558.1 MNNL 83..161 CDD:284966
DSL 220..282 CDD:279722
EGF_CA 350..388 CDD:238011
EGF_CA 490..526 CDD:238011
EGF_CA 610..645 CDD:238011
EGF_CA 647..683 CDD:238011 2/8 (25%)
EGF_CA 798..833 CDD:238011 8/23 (35%)
EGF_CA 879..913 CDD:238011
EGF_CA 916..952 CDD:238011
VWC_out <993..1053 CDD:214565
ankle2XP_004910629.2 Cytadhesin_P30 <36..106 CDD:284643 23/75 (31%)
LEM_ANKL2 118..160 CDD:240591 6/41 (15%)
Cauli_VI 248..298 CDD:396314
Ank_2 400..479 CDD:423045
ANK repeat 400..453 CDD:293786
ANK repeat 455..488 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BAFT
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.