DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser and dlc

DIOPT Version :9

Sequence 1:NP_001287558.1 Gene:Ser / 43275 FlyBaseID:FBgn0004197 Length:1407 Species:Drosophila melanogaster
Sequence 2:NP_001096242.1 Gene:dlc / 100124798 XenbaseID:XB-GENE-968497 Length:642 Species:Xenopus tropicalis


Alignment Length:632 Identity:206/632 - (32%)
Similarity:288/632 - (45%) Gaps:141/632 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 LIALILILLVHKISAAGNFELEILEISNTNSHLLNGYCCGMPAELRATKTIGCSPCTTAFRLCLK 132
            |.|.:.:.|||   .||.|||:|...|......:.|                 .||:..||:|||
 Frog    10 LAATVCLPLVH---PAGVFELKIHSFSTPRPACIAG-----------------RPCSIFFRVCLK 54

  Fly   133 EYQTTEQGASISTGCSFGNATTKILGGSSFVLSDPGVGAIVLPFTFRWTKSFTLILQALDM---- 193
            ..|..   .|....|:||:|.:.||...|..:||.  ..|.:||.|:|...|:||:::...    
 Frog    55 HAQPV---VSPDPPCTFGSAVSDILPYESKAVSDS--SPIRVPFHFKWPGIFSLIIESWTTVSAE 114

  Fly   194 YNTSYPDAERLIEETSYSGVILPSPEWKTLDHIGRNARITYRVRVQCAVTYYNTTCTTFCRPRDD 258
            .:|..||  .|:...:....:....:|....|:|:.:.:.|...|.|...||..:|:.:||||||
 Frog   115 QSTENPD--NLLSRLATRRRLSVGEDWSQDIHLGQQSELRYSYHVSCDEHYYGDSCSDYCRPRDD 177

  Fly   259 QFGHYACGSEGQKLCLNGWQGVNCEEAICKAGCDPVHGKCDRPGECECRPGWRGPLCNECMVYPG 323
            .||||.|..:|.:|||:||:|..|.|.||..||...||.|:.||||:||.||:|.||:||:.|||
 Frog   178 NFGHYTCDEQGNRLCLSGWKGEYCAEPICLPGCSESHGFCEIPGECKCRMGWQGQLCDECVRYPG 242

  Fly   324 CKHGSCNGSAWKCVCDTNWGGILCDQDLNFCGTHEPCKHGGTCENTAPDKYRCTCAEGLSGEQCE 388
            |:||||: ..|:|:|...|||:.|:||||:|..|.||::|.:|.||....|.|.|..|.:|..||
 Frog   243 CQHGSCS-QPWECICQEGWGGLFCNQDLNYCTNHRPCRNGASCINTGQGSYSCNCRAGFTGTNCE 306

  Fly   389 IVEHPCATRPCRNGGTCTLKTSNRTQAQVYRTSHGRSNMGRPVRRSSSMRSLDHLRPEGQALNGS 453
            |..:.||:.||:|||:|                                                
 Frog   307 IDINECASNPCKNGGSC------------------------------------------------ 323

  Fly   454 SSPGLVSLGSLQLQQQLAPDFTCDCAAGWTGPTCEINIDECAGGPCEHGGTCIDLIG--GFRCEC 516
                          ..|..|:.|.|..|:.|..|:|:...|..|||.:|||||:...  |:.|.|
 Frog   324 --------------NDLENDYECVCPRGFYGKNCDISAMTCEDGPCFNGGTCIEKSSGVGYICRC 374

  Fly   517 PPEWHGDVCQVDVNECEAPHSAGIAANALLTTTATAIIGSNLSSTALLAALTSAVASTSLAIGPC 581
            |..:||..|:..::.|                       :|                     .||
 Frog   375 PLNYHGSNCEKKIDRC-----------------------TN---------------------SPC 395

  Fly   582 INAKECRNQPGSFACICKEGWGGVTCAENLDDCVGQ-CRNGATCIDLVNDYRCACASGFKGRDCE 645
            :|..:|.:...:..|.|:.|:.|..|..|:|||... |.||.||:|.||.|.|:|..|:.|:||.
 Frog   396 LNGGQCLDMGRNVLCKCRPGFSGPRCELNIDDCASNPCANGGTCVDAVNSYTCSCTLGYGGKDCT 460

  Fly   646 TDIDECATSPCRNGGECVDMVGKFNCICPLGYSGSLCEEAKENCTPS 692
            ..:|.|::.||.|||.|........|.||.|:.|:.||....:.||:
 Frog   461 LRVDACSSQPCSNGGTCFTHFSGHVCQCPTGFMGTSCEFRVHDPTPA 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SerNP_001287558.1 MNNL 83..161 CDD:284966 23/77 (30%)
DSL 220..282 CDD:279722 27/61 (44%)
EGF_CA 350..388 CDD:238011 16/37 (43%)
EGF_CA 490..526 CDD:238011 15/37 (41%)
EGF_CA 610..645 CDD:238011 18/35 (51%)
EGF_CA 647..683 CDD:238011 13/35 (37%)
EGF_CA 798..833 CDD:238011
EGF_CA 879..913 CDD:238011
EGF_CA 916..952 CDD:238011
VWC_out <993..1053 CDD:214565
dlcNP_001096242.1 MNNL 22..76 CDD:284966 21/73 (29%)
DSL 139..201 CDD:279722 27/61 (44%)
EGF_CA 268..306 CDD:238011 16/37 (43%)
EGF_CA 308..343 CDD:238011 14/96 (15%)
EGF_CA 387..422 CDD:238011 10/78 (13%)
EGF_CA 424..460 CDD:238011 18/35 (51%)
EGF_CA 463..498 CDD:238011 13/34 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D197806at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.