DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5909 and CG18754

DIOPT Version :9

Sequence 1:NP_651544.1 Gene:CG5909 / 43274 FlyBaseID:FBgn0039495 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster


Alignment Length:403 Identity:102/403 - (25%)
Similarity:160/403 - (39%) Gaps:105/403 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLCILPQLVISQ-SSCV--TPAQAAGQCIRYQECPFVQKILGIYGRNIPRKIHNQISEMQCRSTT 72
            :|.:|..:..:| :.||  :..|...:|.|...|..:..||...|.....|  :..:..||....
  Fly     9 ILVLLQAIFFNQLAECVRLSSCQKDEKCTRLVSCSPLMNILRPRGMTQAEK--DVFAHRQCGLDP 71

  Fly    73 NTRDF----HLCCPNEAPPQSNQESQRKVVRSEGGNLNRYDRQGLQLLNSVTNCGNKGNP--KVS 131
            |..:.    ::|||.......|:::                            || :..|  :..
  Fly    72 NGHELLHMVYVCCPELGDVLPNKQT----------------------------CG-QTTPVFRDR 107

  Fly   132 GGKTARPGDFPWVALLKYKINDPRPFRCGGSLISERHILTAAHCII----DQPEVI--AVRLGEH 190
            |.:.|...::||:.||.|:          ..|...|::||||||:|    .|.:::  :||||  
  Fly   108 GAENAELNEYPWMVLLLYE----------NRLSLIRYVLTAAHCVIGGYLTQNDLVLKSVRLG-- 160

  Fly   191 DLESEEDCHYLGGTNRVCIPPYEEYGIEQIRVHPNYVH--GKISHDVAIIKLDRVVKEKSHIKPV 253
              ||..||  :...:| |  |:.:..:.|..||..:..  |...:|:|:::|...|:....|:|:
  Fly   161 --ESTTDC--ITSESR-C--PHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQPI 218

  Fly   254 CLPIDQK--SQELDFDQSFFVAGWGGTEKETVATKLQQALITR--KSLN--ECRQYYNKGEVSDN 312
            || :|.:  .|:|:..    ::||.       .||..|.|||.  |..|  :|...|.... |.:
  Fly   219 CL-LDAEFPLQDLNLQ----ISGWD-------PTKSSQTLITSTVKERNPADCLNRYPSFR-SAS 270

  Fly   313 HICATGTGIKHTCQGDSGGPVF---------FKHRFKNTYRVVQYGVVSFGGRLC-GQNQPGVFA 367
            .:||.|.....||.|.||.||.         |         |...|:.|:|.:.| ....|||:.
  Fly   271 QVCAGGQRKGDTCAGISGSPVMGIMGSGVDEF---------VFLAGIASYGQQYCYSAGIPGVYT 326

  Fly   368 SVIDMLPWITQNL 380
            .:.....||..||
  Fly   327 KIGHFSEWIKANL 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5909NP_651544.1 CLIP 25..82 CDD:197829 14/62 (23%)
Tryp_SPc 129..376 CDD:214473 75/270 (28%)
Tryp_SPc 132..379 CDD:238113 77/270 (29%)
CG18754NP_652652.3 CLIP 35..84 CDD:288855 10/50 (20%)
Tryp_SPc 108..338 CDD:238113 77/270 (29%)
Tryp_SPc 108..335 CDD:214473 75/267 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.