DRSC - DRSC Integrative Ortholog Prediction Tool

Protein Alignment CG5909 and LOC5667996

Sequence 1:	NP_651544.1	Gene:	CG5909 / 43274	FlyBaseID:	FBgn0039495	Length:	381	Species:	Drosophila melanogaster
Sequence 2:	XP_001689277.2	Gene:	LOC5667996 / 5667996	VectorBaseID:	AGAMI1_002916	Length:	399	Species:	Anopheles gambiae

Alignment Length:	31	Identity:	11/31 - (35%)
Similarity:	14/31 - (45%)	Gaps:	8/31 - (25%)

- Green bases have known domain annotations that are detailed below.

  Fly   172 YSAPWTLLLFFAVASFAFSYLFHNLRSWMDR 202
            ||..|.|::.  :||...|||      |..|
Mosquito    28 YSFVWVLIII--IASVTKSYL------WRKR 50

Gene	Sequence	Domain	Region	External ID	Identity
CG5909	NP_651544.1	CLIP	25..82	CDD:197829
CG5909	NP_651544.1	Tryp_SPc	132..379	CDD:238113	11/31 (35%)
LOC5667996	XP_001689277.2	None
Blue background indicates that the domain is not in the aligned region.