DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5909 and f10

DIOPT Version :9

Sequence 1:NP_651544.1 Gene:CG5909 / 43274 FlyBaseID:FBgn0039495 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001015728.1 Gene:f10 / 548445 XenbaseID:XB-GENE-971433 Length:464 Species:Xenopus tropicalis


Alignment Length:364 Identity:105/364 - (28%)
Similarity:170/364 - (46%) Gaps:61/364 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 GQCIRYQECPFVQK----------ILGIYGRN-IPRKIHNQISEMQCRSTTNTRDFHLCCPNEAP 86
            |:|.:|  |..|.:          |||..|:: :|.:.::.......|....|: .|     |..
 Frog   133 GECDQY--CKAVDRDVVCSCTNGYILGENGKSCLPTEKYSCGRRHMKRERRETK-LH-----END 189

  Fly    87 PQSNQESQRKVVRSEGGNLNRYDRQGLQLLNSVTNCGNKGNPKVSGGKTARPGDFPWVALLKYKI 151
            .:::.:||.:|..::.|.|...:..|:.:||.     |..|.::.||:....|:.||.|||   :
 Frog   190 KKNHTDSQNEVKMNQTGTLPERNVTGINILNP-----NDPNVRIVGGRECSQGECPWQALL---V 246

  Fly   152 NDPRPFRCGGSLISERHILTAAHCIIDQPEVIAVRLGEHDLESEEDCHYLGGTNRVCIPPYEEYG 216
            :|.....|||:::|...||||||| ::|.:...|.:||.:.:..|      ||..:       :.
 Frog   247 SDEDEGFCGGTILSREFILTAAHC-MNQTKYFKVVVGELNTKISE------GTESI-------HK 297

  Fly   217 IEQIRVHPNYVHGKISHDVAIIKLDRVVKEKSHIKPVCLPIDQ-KSQELDFDQSFFVAGWG---- 276
            :|:|.:||.:|.....:|:|:|||...:....:|.|.|:|..: ..|.|..:....|:|:|    
 Frog   298 VEKIIMHPRFVKSTYDYDIAVIKLKEAINFTENIIPACIPDPEFADQVLMNEPDAMVSGFGRIHE 362

  Fly   277 -GTEKETVATKLQQALITRKSLNECRQYYNKGEVSDNHICA-TGTGIKHTCQGDSGGPVFFKH-- 337
             |.:..|: ..||...|.|.|..|...:    .:::|..|| ..|.:|..||||||||    |  
 Frog   363 RGRQASTL-QMLQVPYIKRHSCKESSTF----AITENMFCAGFDTEVKDACQGDSGGP----HVT 418

  Fly   338 RFKNTYRVVQYGVVSFGGRLCGQNQPGVFASVIDMLPWI 376
            .||.||.|.  |:||:|.....:.:.||:..|..:..|:
 Frog   419 PFKGTYFVT--GIVSWGEGCARKGKFGVYTKVSKLHRWL 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5909NP_651544.1 CLIP 25..82 CDD:197829 13/59 (22%)
Tryp_SPc 129..376 CDD:214473 80/255 (31%)
Tryp_SPc 132..379 CDD:238113 81/254 (32%)
f10NP_001015728.1 GLA 22..84 CDD:214503
EGF_CA 85..121 CDD:238011
FXa_inhibition 128..163 CDD:373209 9/31 (29%)
Tryp_SPc 228..456 CDD:238113 81/256 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.