DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5909 and CG9733

DIOPT Version :9

Sequence 1:NP_651544.1 Gene:CG5909 / 43274 FlyBaseID:FBgn0039495 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster


Alignment Length:442 Identity:133/442 - (30%)
Similarity:200/442 - (45%) Gaps:89/442 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VSAAIRLGLLLCIL---PQLVISQSSCVTPAQAAGQCIRYQECPFVQKILGIYGR-NIPRKIHNQ 62
            |.||:    .||||   .....|.|.|:.|.|..|.|:...||   |.:..:..| .:..:..:.
  Fly     3 VFAAV----FLCILIAHEAKAQSDSRCLNPNQTPGLCVLINEC---QTLYSVLKRATLTDQEKSF 60

  Fly    63 ISEMQCRSTTNTRDFHLCCP-------------------------NEAPPQS------------- 89
            |....|...:|.:.: :||.                         .|..|||             
  Fly    61 IKSSACGRGSNNQPY-VCCTQDTGYVRIQRQDRTFPDYGAFGGDWEEERPQSFVFPRQERRPWSF 124

  Fly    90 -NQESQ-----RKVVRSEGGNLNRYDRQGLQLLNSVTNCGNKG-NPKVSGGKTARPGDFPWVALL 147
             ||.:.     ||...|:|.:          ||....:||..| ..::..|:.....:|||:.||
  Fly   125 GNQPATSRTPFRKSSTSDGSS----------LLPQPPSCGGVGIRNRIYDGQDTDVNEFPWMVLL 179

  Fly   148 KYKINDPRPF--RCGGSLISERHILTAAHCIIDQPE-----VIAVRLGEHDLESEEDCHYLGGTN 205
            :|:.......  .|.||||:.|::||||||:..:.|     :::|||||||..:..||...||: 
  Fly   180 EYRRRSGNGLSTACAGSLINRRYVLTAAHCLTGRIEREVGTLVSVRLGEHDTRTAVDCPPGGGS- 243

  Fly   206 RVCIPPYEEYGIEQIRVHPNYVHGKIS---HDVAIIKLDRVVKEKSHIKPVCLPIDQKSQELDFD 267
              |.|..:..|.|:||||..|.. |.|   ||:.:|:::|.|:...:|:|:|||.....:.....
  Fly   244 --CSPEVQRLGFEEIRVHERYSE-KASNQVHDIGLIRMERNVRYSDNIQPICLPSSVGLESRQSG 305

  Fly   268 QSFFVAGWGGTEKETVATKLQQALITRKSLNECRQYYN--KGEVSDNHICATGTGIKHTCQGDSG 330
            |.|.|||||.|.|...:...|:..:......:|||.::  |..:....:||.|...|.:|.||||
  Fly   306 QQFTVAGWGRTLKMARSAVKQKVTVNYVDPAKCRQRFSQIKVNLEPTQLCAGGQFRKDSCDGDSG 370

  Fly   331 GPVFFKHRFKNTYRVVQYGVVSFGGRLCG-QNQPGVFASVIDMLPWITQNLQ 381
            ||:.   ||::...|:: |:||||.: || ::.|||:.:|.....||.||::
  Fly   371 GPLM---RFRDESWVLE-GIVSFGYK-CGLKDWPGVYTNVAAYDIWIRQNVR 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5909NP_651544.1 CLIP 25..82 CDD:197829 13/57 (23%)
Tryp_SPc 129..376 CDD:214473 91/259 (35%)
Tryp_SPc 132..379 CDD:238113 93/259 (36%)
CG9733NP_651784.2 CLIP 25..78 CDD:288855 12/56 (21%)
Tryp_SPc 161..412 CDD:214473 91/259 (35%)
Tryp_SPc 162..415 CDD:238113 93/261 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.