DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5909 and CG10232

DIOPT Version :9

Sequence 1:NP_651544.1 Gene:CG5909 / 43274 FlyBaseID:FBgn0039495 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster


Alignment Length:408 Identity:118/408 - (28%)
Similarity:184/408 - (45%) Gaps:90/408 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 VTPAQAAGQCIRYQECPFVQKILGIYGRNIPR-KIHNQISEMQCRSTTNTRDFHLCCPNEAPPQS 89
            :.|.|....|.....|||::         :.| |..|.:...||...|      .|||.:..|..
  Fly   139 IFPCQYDEICRSRDSCPFLK---------LKRKKAQNILMSRQCGINT------YCCPKQEFPDC 188

  Fly    90 NQESQRKVVR------------SEGGNL--NRYDRQGLQLLNS---------------VTNCGNK 125
              .:..|.:|            .:|.||  ||......:.::|               .|:|| :
  Fly   189 --PADEKCIRLDKCLRIHNTTMEDGANLMDNRQCAIDTRRIDSDKRHYICCPEPGNVLPTSCG-Q 250

  Fly   126 GNP--KVSGGKTARPGDFPWVALLKYK-------INDPRPFRCGGSLISERHILTAAHCIIDQPE 181
            ..|  :::.|..|||.::||:|:|.|:       .|:     |.||||::|::||||||::....
  Fly   251 APPLYRMAYGTAARPNEYPWMAMLIYENRRLSTMTNN-----CSGSLINKRYVLTAAHCVVKDKM 310

  Fly   182 VIA------VRLGEHDLESEEDCHYLGGTNRVCIPPYEEYGIEQIRVHPNYVH-GKISHDVAIIK 239
            |..      |||||||:.:..||.:.|.    |..|:.|.|||...||..|.: .:...|:|:::
  Fly   311 VNTDLVLRRVRLGEHDITTNPDCDFTGN----CAAPFVEIGIEYFNVHEQYFNTSRFESDIALVR 371

  Fly   240 LDRVVKEKSHIKPVCLPIDQKSQELDFDQSFFVAGWGGTEKETVATKLQQALITRKSLNECRQYY 304
            |...|:....|.|:|:|.|.....   :....:||||.|:..    :..|.|: ..::.|.| ||
  Fly   372 LQTPVRYTHEILPICVPKDPIPLH---NHPLQIAGWGYTKNR----EYSQVLL-HNTVYENR-YY 427

  Fly   305 NKGEVS----DNHICATGTGIKHTCQGDSGGPVFFKHRFKNTYRVVQY--GVVSFGGRLCGQNQP 363
            .:.::|    ::.|||:|...:.:|:||||||:..  ...|.|:.:.|  |:||:|...||..:|
  Fly   428 CQDKISFFRNESQICASGIRGEDSCEGDSGGPLML--TLNNDYQDIVYLAGIVSYGSENCGDRKP 490

  Fly   364 GVFASVIDMLPWITQNLQ 381
            ||:........||..||:
  Fly   491 GVYTKTGAFFSWIKANLK 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5909NP_651544.1 CLIP 25..82 CDD:197829 13/56 (23%)
Tryp_SPc 129..376 CDD:214473 86/266 (32%)
Tryp_SPc 132..379 CDD:238113 88/266 (33%)
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 88/265 (33%)
Tryp_SPc 260..503 CDD:214473 86/262 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.