DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5909 and CG31220

DIOPT Version :9

Sequence 1:NP_651544.1 Gene:CG5909 / 43274 FlyBaseID:FBgn0039495 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_732440.2 Gene:CG31220 / 326126 FlyBaseID:FBgn0051220 Length:363 Species:Drosophila melanogaster


Alignment Length:379 Identity:102/379 - (26%)
Similarity:161/379 - (42%) Gaps:79/379 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 QCIRYQECPFV------QKILGIYGRNIPRKIHNQISEMQCRSTTNTRDFHLCCPNEAPPQSNQE 92
            :|||.::|..:      .::.|....||.:   .::..:..|.....:..::|||..|       
  Fly    32 ECIRLKDCRPIYYNVRRNRLSGSAKVNISQ---TRMCGVSVRDRKRYKRIYICCPKPA------- 86

  Fly    93 SQRKVVRSEGGNLNRYDRQGLQLLNSVTNCGN-KGNPKVSGGKTARPGDFPWVALLKYK----IN 152
                                 ..|.|..:||. :...:|.||......::||:|:|.|:    .|
  Fly    87 ---------------------NTLPSYPDCGKPQTTNRVIGGTEPNLNEYPWLAMLLYRNRSAFN 130

  Fly   153 DPRPF--RCGGSLISERHILTAAHCIIDQP-EVIAVRLGEHDLESEEDCHYLGGTNRVCIPPYEE 214
            ..|..  .||||||:.|::||||||:.|.. ::..||||||......|| ...|...||.|.:.:
  Fly   131 PDRELVPSCGGSLINTRYVLTAAHCVTDTVLQIQRVRLGEHTTSHNPDC-ISRGARIVCAPTHLD 194

  Fly   215 YGIEQIRVHPNY--VHGKISHDVAIIKLDRVVKEKSHIKPVCLPIDQKSQELDFDQS-----FFV 272
            ..:|.|..|.:|  .:....:|:|:::|...|:......|:|:        ||:.:|     .:|
  Fly   195 IDVESITSHNDYDPANYTFRNDIALVRLKEPVRYTMAYYPICV--------LDYPRSLMKFKMYV 251

  Fly   273 AGWGGTEK-ETVATKLQQALITRKSLNECRQYYNKGEVSDNH------ICATGTGIKHTCQGDSG 330
            ||||.|.. :|.:..|:.|.:..:...||.:.|     :..|      |||.|...:.||.||||
  Fly   252 AGWGKTGMFDTGSKVLKHAAVKVRKPEECSEKY-----AHRHFGPRFQICAGGLDNRGTCDGDSG 311

  Fly   331 GPVFFKHRFKNTYRVVQY--GVVSFGGRLCGQ-NQPGVFASVIDMLPWITQNLQ 381
            .|:.  .....:|..:.:  |:.|:||. ||. ..|.||........||..:|:
  Fly   312 SPLM--GTSGRSYETITFLAGITSYGGP-CGTIGWPSVFTRTAKFYKWIRAHLR 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5909NP_651544.1 CLIP 25..82 CDD:197829 9/53 (17%)
Tryp_SPc 129..376 CDD:214473 83/270 (31%)
Tryp_SPc 132..379 CDD:238113 84/270 (31%)
CG31220NP_732440.2 Tryp_SPc 103..357 CDD:214473 83/270 (31%)
Tryp_SPc 104..360 CDD:238113 85/272 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.