DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5909 and CG33127

DIOPT Version :9

Sequence 1:NP_651544.1 Gene:CG5909 / 43274 FlyBaseID:FBgn0039495 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster


Alignment Length:229 Identity:53/229 - (23%)
Similarity:101/229 - (44%) Gaps:28/229 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 CGGSLISERHILTAAHCIIDQPEVIAVRLGEHDLESEEDCHYLGGTNRVCIPPYEEYGIEQIRVH 223
            ||.|:|.:|.:||||||:.:        |...:.::.....|.|..||..:...:...::....|
  Fly    70 CGASIIGKRWLLTAAHCVDE--------LRTFNGDAVGTPVYAGIINRSNVTAAQVRYVDFASTH 126

  Fly   224 PNYVHGKISHDVAIIKLDRVVKEKSHIKPVCLPIDQKSQELDFDQSFFVA---GWGGTEK--ETV 283
            .::.....|.::|::.:....:..:.::.:.||      :::.|.|...|   |||.|:.  :..
  Fly   127 RSFNGNAGSDNIALLHVSESFEYNARVQQIALP------DINDDYSNKTAAAYGWGLTDPDGDEY 185

  Fly   284 ATKLQQALITRKSLNECRQYY-NKGEVSDNHICATGTGIKHTCQGDSGGPVFFKHRFKNTYRVVQ 347
            :.:||.|.....:...|::.. ....::...:|:.   :| ||.||.|.|:.:   :..|.....
  Fly   186 SKELQYAFAPLLNSTGCKELLPADAPLTAQQVCSQ---VK-TCYGDGGTPLIY---WPITGPAEL 243

  Fly   348 YGVVSFGGRLCG-QNQPGVFASVIDMLPWITQNL 380
            .|:.|:....|| .|:|.|:.||...:.||.|.:
  Fly   244 VGLGSWSYMPCGYANRPTVYTSVPPYIGWIHQTI 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5909NP_651544.1 CLIP 25..82 CDD:197829
Tryp_SPc 129..376 CDD:214473 50/223 (22%)
Tryp_SPc 132..379 CDD:238113 52/226 (23%)
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 52/226 (23%)
Tryp_SPc 41..273 CDD:214473 50/223 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449698
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.