DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5909 and F10

DIOPT Version :9

Sequence 1:NP_651544.1 Gene:CG5909 / 43274 FlyBaseID:FBgn0039495 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_058839.1 Gene:F10 / 29243 RGDID:61850 Length:482 Species:Rattus norvegicus


Alignment Length:405 Identity:107/405 - (26%)
Similarity:175/405 - (43%) Gaps:82/405 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 TPAQAAGQC---IRYQECPFVQKILGIYGRN---IPRK---IHNQISEMQCRSTTNT------RD 76
            :|.|..|:|   :....|...:   |..|:|   ..||   :.|...:..||...|:      :.
  Rat    93 SPCQNQGECRDGLGSYTCTCTE---GFEGKNCELFVRKLCSLDNGDCDQFCREEQNSVVCSCAKG 154

  Fly    77 FHL-----CCPNEAPPQSNQESQRKVVRSEGGNLNRY--DRQGL--------------QLLNSVT 120
            :.|     .|.:.||....:.::.:..||...|.:..  |.:.|              :|||.  
  Rat   155 YFLGNDGKSCLSTAPFPCGKTNKGRAKRSVALNTSNSEPDPEDLMPDADILYPTESPSELLNL-- 217

  Fly   121 NCGNKGNP--------KVSGGKTARPGDFPWVALLKYKINDPRPFRCGGSLISERHILTAAHCII 177
               ||..|        ::.||:..:.|:.||.||| :...:...| |||::::|.:||||||| :
  Rat   218 ---NKTEPEANSDDVIRIVGGQECKRGECPWQALL-FSDEETDGF-CGGTILNEFYILTAAHC-L 276

  Fly   178 DQPEVIAVRLGEHDLESEEDCHYLGGTNRVCIPPYEEYGIEQIRVHPNYVHGKISHDVAIIKLDR 242
            .|.:...||:|:.:.|.|:     ||.        ..:.::.|..|..:.......|:|:::|..
  Rat   277 HQAKRFKVRVGDLNTEQED-----GGE--------MVHEVDMIIKHNKFQRDTYDFDIAMLRLKT 328

  Fly   243 VVKEKSHIKPVCLP-IDQKSQELDFDQSFFVAGWGGT-EKETVATKLQQALITRKSLNECRQYYN 305
            .:..:.::.|.||| .|.....|...::..|:|:|.| ||...:..|:...:.....|.|| ...
  Rat   329 PITFRENVAPACLPQKDWAEATLMTQKTGIVSGFGRTHEKGRQSKVLKMMEVPYVDRNTCR-LST 392

  Fly   306 KGEVSDNHICATGTGIKH--TCQGDSGGPVFFKH--RFKNTYRVVQYGVVSFGGRLCGQNQPGVF 366
            ...::.|..|| |...|.  .||||||||    |  |||:||.|.  |:||:|.....:.:.|::
  Rat   393 SFSITQNMFCA-GYDAKQEDACQGDSGGP----HVTRFKDTYFVT--GIVSWGEGCARKGKYGIY 450

  Fly   367 ASVIDMLPWITQNLQ 381
            ..|...|.||.::::
  Rat   451 TKVTAFLKWIDRSMK 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5909NP_651544.1 CLIP 25..82 CDD:197829 15/74 (20%)
Tryp_SPc 129..376 CDD:214473 76/252 (30%)
Tryp_SPc 132..379 CDD:238113 78/252 (31%)
F10NP_058839.1 GLA 23..84 CDD:214503
EGF_CA 86..122 CDD:238011 8/31 (26%)
FXa_inhibition 129..164 CDD:405372 5/34 (15%)
Tryp_SPc 232..462 CDD:238113 78/253 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.