DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5909 and CG33459

DIOPT Version :9

Sequence 1:NP_651544.1 Gene:CG5909 / 43274 FlyBaseID:FBgn0039495 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_995855.2 Gene:CG33459 / 2768847 FlyBaseID:FBgn0053459 Length:284 Species:Drosophila melanogaster


Alignment Length:264 Identity:88/264 - (33%)
Similarity:130/264 - (49%) Gaps:27/264 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 NCGN-KGNPKVSGGKTARPGDFPWVALLKYKINDPRPFRCGGSLISERHILTAAHCIIDQPEVIA 184
            |||. ....::.||..|.....||:|.|...:.    |.||||||:...:||||||::..|:.:.
  Fly    28 NCGQIPFRMRIFGGMDAGLVSTPWMAFLHNHLQ----FLCGGSLITSEFVLTAAHCVMPTPKNLT 88

  Fly   185 VRLGEHDLESEEDCHYLGGTNRVCIPP---YEEYGIEQIRVHPNYVHGKISHDVAIIKLDRVVKE 246
            |||||:|...:.|          .|.|   :.||.:.:|..||:| ....::|:|::||::.|:.
  Fly    89 VRLGEYDWTRQMD----------SINPKHRHREYMVTRIYTHPSY-RSIAAYDIALLKLNQTVEY 142

  Fly   247 KSHIKPVCLPIDQKSQE----LDFDQSFFVAGWGGTEKETVATKLQQALITRKSLNECRQYYNKG 307
            ...|:|:||.:.:...|    :|..:.|.:.|||.|:.|.|:..||.|.:|:.....|...|.. 
  Fly   143 TVAIRPICLVLPENFHEWYWLVDSVEDFTLTGWGATKTEPVSQVLQSANLTQIDRGTCHDRYGH- 206

  Fly   308 EVSDNHICATGTGIKHTCQGDSGGPVFFKHRFKNTYRVVQYGVVSFGGRLCGQNQPGVFASVIDM 372
            .|...|||| |:.....|.||||.|:..|......|...|.|:||.|.:.|  :...||.:|:..
  Fly   207 SVDHTHICA-GSSKSFACVGDSGSPLAMKVVHNRRYIHAQVGIVSRGPKNC--DGVTVFTNVVSF 268

  Fly   373 LPWI 376
            ..||
  Fly   269 TEWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5909NP_651544.1 CLIP 25..82 CDD:197829
Tryp_SPc 129..376 CDD:214473 83/253 (33%)
Tryp_SPc 132..379 CDD:238113 85/252 (34%)
CG33459NP_995855.2 Tryp_SPc 37..272 CDD:214473 83/253 (33%)
Tryp_SPc 38..272 CDD:238113 83/252 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.