DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5909 and CG33458

DIOPT Version :9

Sequence 1:NP_651544.1 Gene:CG5909 / 43274 FlyBaseID:FBgn0039495 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_995854.2 Gene:CG33458 / 2768846 FlyBaseID:FBgn0053458 Length:281 Species:Drosophila melanogaster


Alignment Length:269 Identity:91/269 - (33%)
Similarity:137/269 - (50%) Gaps:30/269 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 NCG-NKGNPKVSGGKTARPGDFPWVALLKYKINDPRPFRCGGSLISERHILTAAHCIIDQPEVIA 184
            :|| :|...:::||:.:.....||:|.|  .||.  .|.|||||::...:||||||..|:...:.
  Fly    28 DCGISKYTYRITGGRDSPLMLNPWLAYL--HINS--KFICGGSLLNHWFVLTAAHCFRDKNAKVL 88

  Fly   185 VRLGEHDLESEEDCHYLGGTNRVCIPPYEEYGIEQIRVHPNYVHGKISH--DVAIIKLDRVVKEK 247
            |||||:|...:.||:     ...|..|:.||.|.|..:||.|   :.:|  |:|:.||:|.|...
  Fly    89 VRLGENDASQKIDCN-----ESECAAPHLEYMIMQKLIHPLY---RTAHYYDIALAKLNRYVVYT 145

  Fly   248 SHIKPVCLPIDQKSQ-ELDFDQSFFVAGWGGTEKETVATKLQQALITRKSLNECRQYYNKGEVSD 311
            ..|:|:||.::...| .:|..:.|.:.|||.|....|:.|||...|.:.....||.::  |.:.|
  Fly   146 DSIRPICLMLNPNWQVYVDTIRYFIITGWGATNASEVSDKLQLTRIPQIDRFTCRYWF--GYMVD 208

  Fly   312 -NHICATGTGIKHTCQGDSGGPVFFKHRFKNTYRVVQYGVVSFGGRLCGQNQP----GVFASVID 371
             .|||| |....:..:||||||:.....:|...|..|:|:||.      ..||    .||.:::.
  Fly   209 RTHICA-GESKHYVGKGDSGGPLGSMVDYKYAKRFFQFGIVSH------LRQPFHGVSVFTNILS 266

  Fly   372 MLPWITQNL 380
            ...||.:.:
  Fly   267 YSNWIHRTI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5909NP_651544.1 CLIP 25..82 CDD:197829
Tryp_SPc 129..376 CDD:214473 86/254 (34%)
Tryp_SPc 132..379 CDD:238113 88/254 (35%)
CG33458NP_995854.2 Tryp_SPc 37..271 CDD:214473 86/254 (34%)
Tryp_SPc 38..274 CDD:238113 88/256 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.