DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5909 and CG33462

DIOPT Version :9

Sequence 1:NP_651544.1 Gene:CG5909 / 43274 FlyBaseID:FBgn0039495 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster


Alignment Length:272 Identity:83/272 - (30%)
Similarity:130/272 - (47%) Gaps:27/272 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 QGLQLLNSVTNCG---NKGNPKVSGGKTARPGDFPWVALLKYKINDPRPFRCGGSLISERHILTA 172
            ||.|:|.. .:||   |.....|:    |:....||:|.|:    .|:.|.|.|:||:...:|||
  Fly    19 QGFQMLLE-EDCGIPHNISERSVN----AKLAQNPWMAYLE----TPKGFHCSGTLINHLFVLTA 74

  Fly   173 AHCIIDQPEVIAVRLGEHDLESEEDCHYLGGTNRVCIPPYEEYGIEQIRVHPNYVHGKISHDVAI 237
            |||:.|. .:|.|||||::.:::.||     .|.:|..|::||.::....|..|.....::|:.:
  Fly    75 AHCVPDD-LLITVRLGEYNTKTKVDC-----DNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGM 133

  Fly   238 IKLDRVVKEKSHIKPVCLPIDQKSQELDFDQS--FFVAGWGGTEKETVATKLQQALITRKSLNEC 300
            ::|.|.|:..:||:|:|:....:.|| ..||.  |....|..|.....:..|:...|.|:....|
  Fly   134 LRLGRRVEYLNHIRPICIFASNRFQE-PIDQLTWFTTTVWRETAANATSKVLRTMNIDRQPKETC 197

  Fly   301 RQYYNKGEVSDNHICATGTGIKHTCQGDSGGPVFFKHRFKNTYRVVQYGVVSFGGRLCGQNQ-PG 364
            .:.|. ..::...||| |..:...|..|||.|...|.....:.|.||.|:.|   |:.||.| .|
  Fly   198 SEIYG-WNMTFEQICA-GNTLSQLCSTDSGAPQIRKMWHNGSDRYVQLGIAS---RVKGQCQNSG 257

  Fly   365 VFASVIDMLPWI 376
            :...::....||
  Fly   258 ILMDLLSYADWI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5909NP_651544.1 CLIP 25..82 CDD:197829
Tryp_SPc 129..376 CDD:214473 74/249 (30%)
Tryp_SPc 132..379 CDD:238113 75/248 (30%)
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 74/238 (31%)
Tryp_SPc 48..269 CDD:214473 72/236 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.