DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5909 and CG30083

DIOPT Version :9

Sequence 1:NP_651544.1 Gene:CG5909 / 43274 FlyBaseID:FBgn0039495 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster


Alignment Length:260 Identity:84/260 - (32%)
Similarity:135/260 - (51%) Gaps:32/260 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 NCGNKG-NPKVSGGKTARPGDFPWVA-LLKYKINDPRPFRCGGSLISERHILTAAHCIIDQPEVI 183
            |||... :||:..|:.|..|..||:| :.||...:.....|||:||.::.:|:|||| |.:.:::
  Fly    24 NCGYPDISPKIMHGQNAENGTNPWMAYIFKYNDKEVAELVCGGTLIHKQFVLSAAHC-IKRDQIL 87

  Fly   184 AVRLGEHDLESEEDCHYLGGTNRVCIPPYEEYGIEQIRVHPNYVHGKISHDVAIIKLDRVVKEKS 248
            |||||||            .::|.       :.:.:...:..:..|..|:|:.|:::..:||..:
  Fly    88 AVRLGEH------------SSSRY-------FAVTKAFRNKYFTTGSYSNDIGILRIQPIVKFNA 133

  Fly   249 HIKPVCLPIDQKSQELDFDQSFFVAGWGGTEKETVATKLQQALITRKSLNECRQYYNK--GEVSD 311
            .|:|:|:..|  ..::...::|..||||.||.||.:..|:...:...:.:||   ||.  ..|::
  Fly   134 VIRPICIITD--PTKVPNVKTFKAAGWGKTENETFSKVLKTVELNELNASEC---YNMLWVNVTE 193

  Fly   312 NHICATGTGIKHTCQGDSGGPVFFKHRFKNTYRVVQYGVVSFGGRLCGQNQPGVFASVIDMLPWI 376
            :.||| |.....||.||||||:........:.|.||.|::|||..||  |.|||:..:...:.||
  Fly   194 SQICA-GHPDGDTCAGDSGGPLIHPVYMDGSLRYVQLGIISFGSSLC--NSPGVYTRLSSFIDWI 255

  Fly   377  376
              Fly   256  255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5909NP_651544.1 CLIP 25..82 CDD:197829
Tryp_SPc 129..376 CDD:214473 78/249 (31%)
Tryp_SPc 132..379 CDD:238113 79/248 (32%)
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 78/249 (31%)
Tryp_SPc 34..255 CDD:238113 77/248 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.