DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5909 and CG30082

DIOPT Version :9

Sequence 1:NP_651544.1 Gene:CG5909 / 43274 FlyBaseID:FBgn0039495 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster


Alignment Length:271 Identity:94/271 - (34%)
Similarity:136/271 - (50%) Gaps:29/271 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 NCGNKGN----PKVSGGKTARPGDFPWVALLKYKINDPRPFRCGGSLISERHILTAAHCIIDQPE 181
            |||...|    .::.||:||..|..||:|.|    :......|.|:||::|.:|||||| :....
  Fly    27 NCGTTINLPPTNRIVGGRTADIGSNPWLAYL----HKNSSLVCTGTLITKRFVLTAAHC-LHSFH 86

  Fly   182 VIAVRLGEHDLESEEDCHYLGGTNRVCIPPYEEYGIEQIRVHPNYVHGK--ISHDVAIIKLDRVV 244
            ::.|||||:|..:..||     |:..|||.||||.:|...:| .:..|:  ..:|:.::||:..|
  Fly    87 LLTVRLGEYDTSTRIDC-----TSEFCIPTYEEYSVENAYIH-TFFGGRQDSRNDIGLLKLNGTV 145

  Fly   245 KEKSHIKPVCLPIDQKSQELDFDQSFFVAGWGGTEKETVATKLQQALITRKSLNECRQYYNKGEV 309
            ..|..|:|:||..|  ..::.:..::..||||..:....||.||...:.|...::|.:.. :..:
  Fly   146 VYKLFIRPICLFRD--PGQVPYSSTYEAAGWGKIDLINTATVLQTVNLIRLDQSDCERSL-RTSL 207

  Fly   310 SDNHICATGTGIKHTCQGDSGGPVFFKHRFKNTYRVVQYGVVSFGGRLCGQNQPGVFASVIDMLP 374
            |....|| |.....||.||||||:..|.......|.||.|:||:|..||  ..|||:..|.....
  Fly   208 SYGQFCA-GQWRADTCSGDSGGPLSRKMSNGRITRTVQLGIVSYGHYLC--RGPGVYTYVPSFTN 269

  Fly   375 WI------TQN 379
            ||      |||
  Fly   270 WILSITRWTQN 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5909NP_651544.1 CLIP 25..82 CDD:197829
Tryp_SPc 129..376 CDD:214473 85/248 (34%)
Tryp_SPc 132..379 CDD:238113 88/254 (35%)
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 85/248 (34%)
Tryp_SPc 40..274 CDD:238113 87/250 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.810

Return to query results.
Submit another query.