DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5909 and Klk1b3

DIOPT Version :9

Sequence 1:NP_651544.1 Gene:CG5909 / 43274 FlyBaseID:FBgn0039495 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_113711.1 Gene:Klk1b3 / 24594 RGDID:3175 Length:265 Species:Rattus norvegicus


Alignment Length:266 Identity:71/266 - (26%)
Similarity:113/266 - (42%) Gaps:50/266 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 KVSGGKTARPGDFPWVALLKYKINDPRPFRCGGSLISERHILTAAHCIIDQPEVIAVRLGEHDLE 193
            :|.||........||...:.|.    ..:.|||.||....::|||||..|..:   |.||.::|.
  Rat    28 RVVGGYNCEMNSQPWQVAVYYF----GEYLCGGVLIDPSWVITAAHCATDNYQ---VWLGRNNLY 85

  Fly   194 SEEDCHYLGGTNRVCIPPYEEYG-IEQIRVHPNYVHGKI-----------SHDVAIIKLDRVVKE 246
            .:|              |:.::. :.|...||.:....|           |:|:.::.|.:....
  Rat    86 EDE--------------PFAQHRLVSQSFPHPGFNQDLIWNHTRQPGDDYSNDLMLLHLSQPADI 136

  Fly   247 KSHIKPVCLPIDQKSQELDFDQSFFVAGWGGTEKE--TVATKLQQALITRKSLNECRQYYNKGEV 309
            ...:|.:.|||    :|.....:...:|||....:  .::..||...|...|..:|.:.: |.||
  Rat   137 TDGVKVIDLPI----EEPKVGSTCLASGWGSITPDGLELSDDLQCVNIDLLSNEKCVEAH-KEEV 196

  Fly   310 SDNHICA-TGTGIKHTCQGDSGGPVFFKHRFKNTYRVVQYGVVSFGGRLCGQ-NQPGVFASVIDM 372
            :|..:|| ...|.|.||:||||||:....        |..|:.|:|...||: .:||::..:|..
  Rat   197 TDLMLCAGEMDGGKDTCKGDSGGPLICNG--------VLQGITSWGFNPCGEPKKPGIYTKLIKF 253

  Fly   373 LPWITQ 378
            .|||.:
  Rat   254 TPWIKE 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5909NP_651544.1 CLIP 25..82 CDD:197829
Tryp_SPc 129..376 CDD:214473 69/262 (26%)
Tryp_SPc 132..379 CDD:238113 70/263 (27%)
Klk1b3NP_113711.1 Tryp_SPc 28..257 CDD:214473 69/262 (26%)
Tryp_SPc 29..260 CDD:238113 71/265 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.