DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5909 and F10

DIOPT Version :9

Sequence 1:NP_651544.1 Gene:CG5909 / 43274 FlyBaseID:FBgn0039495 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_000495.1 Gene:F10 / 2159 HGNCID:3528 Length:488 Species:Homo sapiens


Alignment Length:402 Identity:107/402 - (26%)
Similarity:176/402 - (43%) Gaps:69/402 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 CVT-PAQAAGQC--------------IRYQECP-FVQKILGIYGRNIPRKIHNQISEMQC---RS 70
            |.| |.|..|:|              ...:.|. |.:|:..:...:..:..|.:.:.:.|   |.
Human    90 CETSPCQNQGKCKDGLGEYTCTCLEGFEGKNCELFTRKLCSLDNGDCDQFCHEEQNSVVCSCARG 154

  Fly    71 TTNTRDFHLCCPNEAPP---QSNQESQRKVVR--SEGGNL------NRYDRQGL-------QLLN 117
            .|...:...|.|....|   |:.:..:|.|.:  |..|..      ..||...|       .||:
Human   155 YTLADNGKACIPTGPYPCGKQTLERRKRSVAQATSSSGEAPDSITWKPYDAADLDPTENPFDLLD 219

  Fly   118 ---SVTNCGNKGNPKVSGGKTARPGDFPWVALLKYKINDPRPFRCGGSLISERHILTAAHCIIDQ 179
               :....|:....::.||:..:.|:.||.|||   ||:.....|||:::||.:|||||||:. |
Human   220 FNQTQPERGDNNLTRIVGGQECKDGECPWQALL---INEENEGFCGGTILSEFYILTAAHCLY-Q 280

  Fly   180 PEVIAVRLGEHDLESEEDCHYLGGTNRVCIPPYEEYGIEQIRVHPNYVHGKISHDVAIIKLDRVV 244
            .:...||:|:.:.|.||     ||.        ..:.:|.:..|..:.......|:|:::|...:
Human   281 AKRFKVRVGDRNTEQEE-----GGE--------AVHEVEVVIKHNRFTKETYDFDIAVLRLKTPI 332

  Fly   245 KEKSHIKPVCLP-IDQKSQELDFDQSFFVAGWGGT-EKETVATKLQQALITRKSLNECRQYYNKG 307
            ..:.::.|.||| .|.....|...::..|:|:|.| ||...:|:|:...:.....|.|: ..:..
Human   333 TFRMNVAPACLPERDWAESTLMTQKTGIVSGFGRTHEKGRQSTRLKMLEVPYVDRNSCK-LSSSF 396

  Fly   308 EVSDNHICA-TGTGIKHTCQGDSGGPVFFKH--RFKNTYRVVQYGVVSFGGRLCGQNQPGVFASV 369
            .::.|..|| ..|..:..||||||||    |  |||:||.|.  |:||:|.....:.:.|::..|
Human   397 IITQNMFCAGYDTKQEDACQGDSGGP----HVTRFKDTYFVT--GIVSWGEGCARKGKYGIYTKV 455

  Fly   370 IDMLPWITQNLQ 381
            ...|.||.::::
Human   456 TAFLKWIDRSMK 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5909NP_651544.1 CLIP 25..82 CDD:197829 14/75 (19%)
Tryp_SPc 129..376 CDD:214473 78/251 (31%)
Tryp_SPc 132..379 CDD:238113 80/251 (32%)
F10NP_000495.1 GLA 25..85 CDD:214503
EGF_CA 86..122 CDD:238011 6/31 (19%)
FXa_inhibition 129..164 CDD:317114 4/34 (12%)
O-glycosylated at one site 183..203 3/19 (16%)
Tryp_SPc 235..464 CDD:238113 80/252 (32%)
O-glycosylated at one site 476..485
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.