DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5909 and try-1

DIOPT Version :9

Sequence 1:NP_651544.1 Gene:CG5909 / 43274 FlyBaseID:FBgn0039495 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_494910.2 Gene:try-1 / 173856 WormBaseID:WBGene00006619 Length:293 Species:Caenorhabditis elegans


Alignment Length:263 Identity:79/263 - (30%)
Similarity:117/263 - (44%) Gaps:42/263 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 KVSGGKTARPGDFPWVALLKYKINDPRPFRCGGSLISERHILTAAHCIID--QPEVIAVRLGEHD 191
            ::.||..:.|..:||...|..::..   .|||||||....:||||||...  :|...:||:|.|.
 Worm    57 RLIGGSESSPHSWPWTVQLLSRLGH---HRCGGSLIDPNFVLTAAHCFAKDRRPTSYSVRVGGHR 118

  Fly   192 LESEEDCHYLGGTNRVCIPPYEEYGIEQIRVHPNYVHG-KISHDVAIIKLDRVVKEKSHIKPVCL 255
            ..|       |..:||          ..:.:||.|..| ..|:|.||:::...|...:..:|:||
 Worm   119 SGS-------GSPHRV----------TAVSIHPWYNIGFPSSYDFAIMRIHPPVNTSTTARPICL 166

  Fly   256 PIDQKSQELDFDQSFFVAGWGGT-EKETV-ATKLQQALITRKSLNECRQYYNK-GEVS-DNHICA 316
            |    |.....::...|.|||.| |..:: |..|::..:...|...|....|. |.:. .:.:||
 Worm   167 P----SLPAVENRLCVVTGWGSTIEGSSLSAPTLREIHVPLLSTLFCSSLPNYIGRIHLPSMLCA 227

  Fly   317 -TGTGIKHTCQGDSGGPVFFKH--RFKNTYRVVQYGVVSFGGRLCGQNQPGVFASVIDMLPWITQ 378
             ...|...:||||||||:....  .::.|      ||||:|........|||:.:|.....||  
 Worm   228 GYSYGKIDSCQGDSGGPLMCARDGHWELT------GVVSWGIGCARPGMPGVYGNVHSASTWI-- 284

  Fly   379 NLQ 381
            ||:
 Worm   285 NLE 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5909NP_651544.1 CLIP 25..82 CDD:197829
Tryp_SPc 129..376 CDD:214473 75/256 (29%)
Tryp_SPc 132..379 CDD:238113 77/256 (30%)
try-1NP_494910.2 Tryp_SPc 59..285 CDD:238113 77/257 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.